Harvest Fest Profile Pics

fallautumnpumpkinharvestfarmerhappyfestivalharvest festivalfarm
funny kanan gill smiling laughing cheerful

Entregando canastas ! Elige la tuya en la publicación anterior ! #koonna_vega @koonna_ - @koonna_ on Instagram

sziget sziget festival

- The boss (right) showed up to the patch to make sure Halloween 🎃 was still on schedule.

food korean korea koreanfood bibimbap

- Fast Growing Trees

farmer donald duck disney animated cartoon

- Art pieces

dance blue cute head bang fun

- all things winter food drinks appetizers desserts etc.

sporky happy thanksgiving happy harvest apple picking fall

- Keep Texas Beautiful

%E3%83%80%E3%83%B3%E3%82%B9 %E3%83%8E%E3%83%AA%E3%83%8E%E3%83%AA %E3%83%91%E3%83%BC%E3%83%86%E3%82%A3%E3%83%BC %E3%82%AD%E3%83%A2%E3%82%AB%E3%83%AF %E3%83%99%E3%82%BF%E3%83%83%E3%82%AF%E3%83%9E

Its Pumpkin season! #pumpkin #pumpkinseason #fall #fallseason #adolfocojulunhass @expressionsartesflorales @cristianalopezm - @adolfocojulunhass on Instagram

harvest moon moon heart full moon crazy spooktober

All of our Rumiano Family Organic Cheeses (and butter!) are certified Organic and Non-GMO. Whats your favorite kind of Rumiano Cheese!? - @rumianocheese on Instagram

thisisforkyleonly doge doge dance cute

As we continue to celebrate National Farmers Market Week, we love Gila Valley Farmers Market. Its open everyday except Sunday - 6 DAYS PER WEEK!!! You can pop in for a lemon cucumber from Country Mamas Farm; pick up a few zukes for stuffed zucchini on the grill from Dankworth Lake Farm; or Sativa Lip Balm for your hike around Mt. Graham. Check out their website for seasonal farm updates. https://www.grahamchamber.org/gilavalleyfarmersmarket.html #SupportGilaValleyRanchers #GilaValleyGrown #GilaValleyMade #BuyLocal #theGilaValleyEatsLocal #ShopLocalGilaValley #arizonafarmersmarket #farmersmarket #visitarizona #visitthegilavalley #worldfamoussalsatrail #grahamcountychamber #GilaValleyFarmersMarket #SupportGilaValleyFarmers - @goodfoodaz on Instagram

wishing goodmorning virumpuki%E1%B9%9F%C4%93%E1%B9%89 tamil

- APPLE BOARDS

thats funny violet sort of lol haha

- So many colors

autumn fall harvest nature four season

🍅 • nothing inspires trays like the allotment and nothing tastes better than a freshly grown tomato. • #allotment #gunsiteallotments #dulwichwoods #beans #tomatoes #fresh #collageinspo #collage #produce #hotpink #colourinspo - @arby.trays on Instagram

manpower group cute tiger tiger huat huat ah

Done a clean-up as part of #AutumnCleanCymru? We want to know what you found! 🚮 Did you find any interesting items? What are your thoughts on the campaign? Tell us in our online survey, available on our Autumn Clean Cymru page or click on the link in our bio. Wedi gwneud digwyddiad glanhau fel rhan o #HydrefGlânCymru? Rydyn ni eisiau gwybod beth wnaethoch chi ei ddarganfod! 🚮 A ddaethoch o hyd i unrhyw eitemau diddorol? Beth yw eich meddyliau am yr ymgyrch? Dywedwch wrthym yn ein harolwg arlein byr, ar ein tudalen Hydref Glan Cymru, dolen yn ein bio #survey #recycleweek2020 #cleanup #litterpick #litterpickfinds #wales #cymru #arolwg #hydrefglân #glanhau #cadwchcymrundaclus - @keepwalestidy on Instagram

recycle mid autumn lattern happy mid autumn festival

- Copa do Mundo

chinese new year happy chinese new year pig %E6%96%B0%E5%B9%B4%E5%BF%AB%E4%B9%90 %E7%8C%AA%E5%B9%B4

- All Things Redneck

crying grogu tyson

KILLIN’ IT! #hemp #hempdrying #hempdryer #hempfarmers #cthempfarmers #hempfarmersofamerica #cbd #cbdoil #heal #sustainability #townfarm #ctvalleyhemp #extraction #hempcommunity #cbdcommunity #green #connecticut @ctvalleyhemp - @town_farm on Instagram

bfkm ballettf%C3%B6rderkreis m%C3%BCnchen ev wir lieben tanz we love to dance

- Birthday/Party Ideas

pumpkin halloween

- Buddys Custom Catering | Knoxville Wedding Caterer

tag der deutschen einheit sch%C3%B6nen tag der deutschen einheit deutsche einheit tag der einheit

- Making dinner for an omni and Im clueless. This is what I bought. Help!

happy baisakhi balle balle harvest festival

Celebrate spooky season at Haunted Hayride on Saturday, October 24! Reservations are required and space will be limited, so mark your calendar to secure a ticket and trailer starting October 1! Learn more about this event on templeparks.com (link in bio), and get ready to have un-BOO-lievable time! Calling all volunteers for October Events! Fill out an Interest Form at the link in our bio. This photo was taken pre-COVID-19. Safety guidelines will be in place to keep all guests safe at this event. #TempleRec - @cityoftempleparks on Instagram

barbara genshin impact genshin mihoyo hoyoverse

- Halloween Fright Night!!!!

mid autumn day mid autumn fall fall festival moon cakes

- God bless us all

loof and timmy loof bread cute bread dinosaur

- halloween costumes

thanksgiving week

- catawba county

%E5%9B%B0%E4%BA%86 %E7%9D%A1%E8%A7%89 %E5%B0%8F%E7%9D%A1 %E4%BC%91%E6%81%AF zzz

- Our Staff and Their Pets

dance4liberation rave party festival netherlands festival

The difference between a normal Caesar salad and the Ovlo caesar? Our Caesar salad has house-made roasted tomatoes, marinated olives and made-from-scratch Greek yogurt dressing. It is also Dylans new Ovlo favorite! Try today as a side-kick or entrée salad with thinly-sliced herb-grilled chicken or your choice of protein. . . . . #OvloPlantation #OvloEats #SoFlo #SouthFLLocal #FortLauderdale #SouthFL #SouthFlorida #Eeeeeats #YelpFortLauderdale #SupportLocal #OhLaudy #FtLauderdale #LauderdaleLife #LauderdaleLiving #HealthyLife #Delish #YelpFortLauderdale #LocalEats #Local #EatLocal #StayFresh - @ovloeats on Instagram

cine center yo heart cinema cine

- Blogs about Canola Oil

dance festival music happy

- Adult Drinks

tvr the vast realm

- All in a prims day

autumn fall season nature

- Country Concert Outfits

%E0%B8%95%E0%B8%A3%E0%B8%B8%E0%B8%A9%E0%B8%88%E0%B8%B5%E0%B8%99 %E0%B8%95%E0%B8%A3%E0%B8%B8%E0%B8%A9%E0%B8%88%E0%B8%B5%E0%B8%992021 %E0%B8%95%E0%B8%A3%E0%B8%B8%E0%B8%A9%E0%B8%88%E0%B8%B5%E0%B8%992564 %E0%B8%A7%E0%B8%B1%E0%B8%99%E0%B8%95%E0%B8%A3%E0%B8%B8%E0%B8%A9%E0%B8%88%E0%B8%B5%E0%B8%99 %E0%B8%A7%E0%B8%B1%E0%B8%99%E0%B8%95%E0%B8%A3%E0%B8%B8%E0%B8%A9%E0%B8%88%E0%B8%B5%E0%B8%992564

- Gift Basket Ideas

ron swanson fried sausage quilts state fair excuse me lunch

Today, we closed the gardens for the winter. We cleaned out and gleaned from our p-patch gardens and our SAGE garden at our Greenwood Senior Center. Thanks to volunteers from Discovery Church and Kathy Pruzan for all their help. ⁠ ⁠ Thank you to ALL our volunteers during the entire growing season. We grew 196 lbs of produce that went to our delivered lunches to seniors. This is the most we have ever grown in a season! Some positive 2020 news! ⁠ ⁠ #communitygarden⁠ #greenwoodseniorcenter⁠ #greenwood⁠ #phinney⁠ #phinneyridge⁠ #nwseattle⁠ #northseattle⁠ ⁠ - @phinneyneighborhoodassociation on Instagram

tsu nami music tsu nami tsu nami bitbird tsu nami easy to love

#2019 GPC Weigh-Off @Pinkham’s Plantation, Damariscotta, ME, New State Record: Giant Pumpkin - Edwin Pierpont, Jefferson, Maine, 1832.5 lbs. #damariscottapumpkinfest #giantpumpkin #pumpkin #pumpkins #growyourown #maine @mainespumpkintrail - @damariscottapumpkinfest on Instagram

harvest festival rimuru tempest wisdom king raphael merciless

- Sand tarts

tanzen dayot upamecano rb leipzig tanzen lassen f%C3%BChlen

- Food Rescue, Gleaning

h3 h3h3 h3podcast gary gary h3

- TIPS & HEALTHY FOOD/RECIPES

heart sticker retro nintendo crypto

- Permaculture Design Course

peterson farm bros superman farmer super farmer harvest festival

- Fall Decorations

david chang sushi nigiri seaweed pho

An Cathaoirleach Una Power was tree planting with the parks department in #Shanganagh Park, in support of Lá na gCrann 2020, #TreeDay - @dlrcoco.ie on Instagram

harvest yeahilif

- Barn party

chill relax autumn leaves todd

Apples are packed into bins in the orchard, then transported to the packing warehouse where they will be washed, sorted packed and shipped. #journeyofanapple #washingtonapples #galas #appleaday #harvest2020 - @washingtonapplecommission on Instagram

happy mid autumn day mid autumn day mid autumn fall fall festival moonlight

- Eat a rainbow! 🌈

carl reiner red pixel art

- Fall harvest from last year

fall autum camel pumpkin season

- campfire party

cute lovely couple happy charming

- I grew a giant pumpkin. It might not be the biggest in the world but I gave it my all and was a huge accomplishment for Oklahoma. 722lbs

diadeacciondegracias diadelpavo latinthanksgivin

- Alimentari: Italian Favorites

joe biden inflation inflationreductionact bbt liberal

Did you know that Pepino Melons arent actually melons at all? They’re from the same family as tomatoes and eggplants! Ranging from the size of an egg to a little smaller than your hand, these little melons are fragrant, like a cantaloupe or honeydew, but their texture is more like a cucumber. Head to our link in bio to add some to your order so you can try them for yourself! - @goodeggs on Instagram

autumn mid autumn happy fall

- Popcorn festival

space laces

- Wedding Entertainment

halloween jack o lanterns pumpkins autumn fall

- These are our very first pumpkins!! We are very proud 😊

db

- Fun Fun Fun Fest

mid autumn day mid autumn fall fall festival moon cakes

- 1st Birthday ideas

halloween creepy spooky

Nu när sommaren lider mot sitt slut så undrar vi vilka av era odlingar som gett bäst resultat i år – och vilka som varit besvikelser? Våra gemensamma kunskaper på denna sida kan hjälpa andra följare att hitta rätt till nästa års odlingar! Dela med dig av dina erfarenheter i kommentarerna! Foto: Shutterstock/TT . . . #skörd #trädgård #skörda #sommarskörd #odla #odling #skördetid #skördetider #trädgårdar #trädgårdsodling #trädgårdsodlingar #frukt #grönt #fruktochgrönt #grönsak #grönsaker #odlagrönsaker #odlafrukt #frukter - @allerstradgard on Instagram

happyhalloween greeting jackolanters pumpkins festive

- Dino party

v efpmu 2020 sparkling sparkle

- FODMAP friendly recipes

happy thanksgiving

- Africa The Mother Land

kitty cookie

- Canning-Freezing-Fermenting

funny_baby_reaction_scotts_a_dick

- Classroom window decorations

cny dbs happy chinese new year happy new year dbssme

- Being Prepared

bnk48 bnk48festival festival bnkfestival dance

- Desserts xmas

clippy

- Rose hips collected from the garden today

halloween jack lantern festival pumpkin

Im Herbst heißt es dann Endspurt: Die Südtiroler Obstbauern beginnen mit der Ernte. Wir haben euch bereits erklärt, dass mittels eines Reifetests die „inneren Werte“ der Äpfel 🍎 wie Zucker, Fruchtfleischfestigkeit, Stärkeabbau und Säure ermittelt werden und anhand dieser Reifeparameter die sortentypischen Erntefenster festgelegt werden. Die Ernte startet in Südtirol Mitte August mit der Sorte Gala und endet mit der spätreifen Sorte Cripps Pink (Clubapfel Pink Lady®) im November. Die Äpfel werden sorgsam und ganz traditionell von Hand „geklaubt“, wie der Südtiroler sagt. Meistens sind mehrere Durchgänge nötig, um alle Äpfel abzuernten. Auch unsere fleißigen Apfelbauern Iris und Joachim haben mit der Ernte der Gala begonnen. Die Äpfel werden mit der Hand vorsichtig gepflückt und in den Erntekorb gelegt. Sobald dieser voll ist, wird er in der Großkiste entleert und dann wieder befüllt. Bei unserer Apfelbäuerin Iris hat heuer leider auch der Hagel Schaden hinterlassen. Das Fallobst räumt Iris dabei händisch weg. Wer von euch hat auch schon einmal Äpfel geerntet? Schreibt uns eure Erfahrungen in die Kommentarbox 👇 oder zeigt uns euer Erntebilder 📸 mit #mirklaubn. Wir freuen uns! 😍 . . . #obstbau #wirliebenäpfel #ernte #neueernte #mirklaubn #apfel #südtirolerapfel #suedtirolerapfel #landwirtschaftistleidenschaft #apfelbauer #apfelbäuerin #wissenwoesherkommt #südtirolerapfelwelt #suedtirolerapfelwelt #südtirolerlandwirt #alleswaswirlieben #apfelgeschichten - @wir_lieben_aepfel on Instagram

%E5%85%83%E5%AE%B5%E8%8A%82%E5%BF%AB%E4%B9%90 %E6%B1%A4%E5%9C%86 %E5%8F%AF%E7%88%B1 %E7%86%8A%E7%8C%AB lantern festival

- Zone 5B. Calls for frost tonight 😡.Had to bring in a few veggies early to be safe. Its not a lot, I wont be a farmer anytime soon but its a fun hobby and I learned a ton in my first year. Still lots left to harvest yet...

harvest festival

- Family Reunions

together we can modernize our infrastructure american jobs plan infrastructure clean water renewable energy

- I grew some winter squash! And some baby boos 👻

thanksgiving gif card giraffe animal sunshine food veggies fruit

- Just a few things from my garden today

radio dance muzik taniec romantic

- Currently in an apartment, so I’m living vicariously through my father in law and his master fig growing skills

italian fall festival pfsmd fall show gorilla gorilla dancing he has ride

Today, we were so honored to receive the 2020 U.P. Service Award in the Business Community Leader category. The U.P Service Awards, sponsored by Grow & Lead: Community and Youth Development, recognize exemplary volunteer and charitable efforts throughout the Upper Peninsula. A big thank you to the staff at Gogebic Range Health Foundation for nominating us for this wonderful honor. We are so proud to call the U.P. our home and will continue to do our part to make this a great place to live.⁠⠀ ⁠⠀ #stormykromer #growandlead #service #philanthropy #community #giveback @grhf01 #upperpeninsula #upserviceawards #ironwoodmichigan - @stormykromerofficial on Instagram

nyaff new york asian film festival

- Rainbow carrots for dinner!

gabario hotdog the harvest is bountiful this year harvest bountiful

- foraging, hunting & fishing

mobile legends bang bang mlbb ml moba

- Redneck outfits

love you

- “Gardening is cheaper than therapy and you get tomatoes” .. yes but is it a problem if I have approx total 200 pounds worth ?

cant sleep late night bang head sorry oops

- Steampunk Fairy

oktoberfest fall season happy oktoberfest autumn mid autumn

- St. Joes

chinese new year ox year of the ox happy chinese new year chinese

9 more weeks until the general election on November 3rd. Now that its September, those 9 weeks are going to fly by. Make sure youre prepared to vote and remember that EVERY VOTE MATTERS. Your vote is your voice so make sure you are heard. To better understand your choices check out some great non-partisan resources from the @aclu_nationwide, link in bio. Already registered to vote? Encourage your friends, family members, neighbors, and co-workers to do the same. *photo taken in February 2020 - @seacoasteatlocal on Instagram

tractor treker dectins harvest fest

- boys birthday!

nick lubs l%C3%BCbs nick lubs edm

- Pups first concert

happy thanksgiving pumpkin roses flowers

- Topless tailgater bounces on a trampoline

party yakiumin 108

- Games

kid mad news

- Around Ky

good morning2022 celebrate excited bye2021 lunar new year

- After thanksgiving dinner

fall back this sunday fall clocks go back clocks back

Se vino el calorcito y nosotros ya estamos pensando en disfrutar de unas buenas sandías como hacemos todos los años 🍉☀️ #campo #love #sun # #field #viaje #tractor #game #kids #tradicion #travel #menonitas #picoftheday #video - @coloniasmenonitas on Instagram

tkthao219 bubududu panda

- Harvest

happy fall fall fall time happy harvest harvest

- corn maze

balloon colorful google colors blue red

- Buckeye cake

ron swanson parks and rec parks and recreation lil sebastian gleeful

- Oregon country fair

mooncake cat mooncake festival midautumn mid autumn festival

Tänäkin torstaina #hommareilassa️ ja Seifit starat vauhdissa! Arvaatko missä myymälässä ollaan?🤔🤩 ⭐️ Lisää meininkiä sivuillamme - LINKKI BIOSSA ⭐️ #reilameno #reila #turvallisuusala #seifi - @reilapalvelutoy on Instagram

farm farmer farming charlottes web have a wonderful time

- Viking Cooking

tet trung thu ngay trung thu le hoi banh trung thu happy mid autumn festival moon festival

- Bacon

happy fall hot aihot air

Landlust houses are at least 100 years old, have been revitalised carefully and are rooted in the surrounding nature like a cottage garden or a meadow of flowers. Enchanting holiday dreams become reality in the cosy, rustic Landlust houses. #landlust #austria #visitaustria #discoveraustria #edendestinations #youreedenexperience #Travel #travelphotography #travelgram #instatravel #traveltheworld #traveling #beautifuldestinations #traveldestination #beautifulplaces #exploretheworld #topeuropephoto #traveleurope #wanderful_places #europetrip #sustainabletourism #ecotourism #responsibletravel #responsibletravel - @edendestinations on Instagram

oto%C3%B1o otono autumn autunno automne

- corn maze

dochardy pumpkin shrug

- Souvenir Store

fall health rain autumn wind

- Animal cell project

seasonal thanksgiving food fruit animal

- First haul!

hurrah party congratulations festival spring festival

- NC - ADVENTURES NEAR HOME

superman have a super time harvest fest

August is here, and so is the local sweet corn! Do you eat yours horizontally or vertically? #nowronganswer #cornonthecob Photo courtesy of @berkgrown at Berkshire Area Farmers Market in Lanesborough - @berkshirefarmersmarkets on Instagram

thanksgiving week harvest of blessings

Throwback to Big Barrel Surfing on the set of #Jackass3D. While I’ll never forget some of the great rides I got that day, Ryan’s banzai boogie attack was beyond compare! 📸: @cordell71 #machoassholeswithadeathwish #jackass - @chrispontius on Instagram

betty archie barchie riverdale twitter

- Tapas Party

karabakh qarabakh lachin shusha

A week and a half ago we loaded up a truck with all our chocolate machines and away they went to our soon to be new factory in Charleston, UT.⠀ ⠀ We’ve been building to this point for the last 6 months but today brought on the emotions. New beginnings are here but it’s always a little tough to say goodbye to the old. This 2,500 sq ft space on Iron Horse drive has done us proud for 5 years. It’s been our chocolate factory home with so much growth and support along the way. Its moments like these that really make you pause for thought on how far we’ve come and the lessons learned.⠀ ⠀ I’m so incredibly excited for our next step in our chocolate journey but I think I’ll always kinda miss our little space in PC that was a dream we reached for back in Denver that we brought to life. Cheers to many more chocolate dreams ahead! 🥂 🍫 Can’t wait for everyone to see the new space. ❤️⠀ ⠀ — Ritual co-founder Anna Davies.⠀ ⠀ #chocolatefactory #craftchocolate #ritualmoment⠀ - @ritualchocolate on Instagram

farm farmer farming pizza nick offerman

- canning &preserving

- Canning tomato soup

- A buddy of mines grandfather decided to give all the grand kids a firearm for Christmas.

- Game Time Celebration!

- Ill have to get creative with all our tomatoes haha... roma, evergreen, basinga, and sun yellow 😋

- Growing Rhubarb

In previous years, fall at The Farm has meant apple picking, corn-mazing, animal petting, pumpkin hunting, and family fun. It goes without saying, this year is different. While we understand the powerful human need to celebrate the annual harvest and the glorious land that we have farmed for over a century - the safety of our employees and customers comes first. This was an extremely difficult decision for us, but Hickory Nut Gap Farm will not be open for our traditional fall activities. Our online store offers plenty of opportunities to enjoy the tastes of autumn, including our crisp, local apples and cider. You can also shop for grass-fed and pasture-raised meats, other local grocery items, and sign up for our growing CSA program. We will also be offering private tours and farm experiences for companies, organizations, or other groups (using COVID-safe protocols). Thank you for your understanding, and we look forward to helping coordinate a fall farm experience that celebrates the season! #WNC #localcider #localapples #carolinainthefall #WNCFall #grassfedbeef #pastureraisedpork #regenerativeagriculture #regenerativefarming #localmeat #sustainablefarming #CSA #asheville #familyfarm #hickorynutgap #agrotourism #GAPcertified - @hickorynutgap on Instagram

- Went on holiday for a week. Came back to this. (With a little Bolivian Rainbow pepper)

- My parents fall basket,all organic :)

- AaHalloween Crafts, Games & Treats

- Knife Throwing

Busy busy busy! Lots of orders going out today. #buttersfarms - @buttersfarm on Instagram

- SCARECROWS

Our booth at the Vermont Cheesemakers festival at Shelburne Farms. Come check us out! Also our view on our way over to the festival this morning - @sidehillfarm on Instagram

- Calgary Stampede

- Garden

- Fall squash and melon harvest!

- Autumnal colour

- Finger foods

- PRIMITIVE FALL CRAFTS

- My second harvest of my orange wonder chillies.

- Fall Outdoor Decorating

- Summer abundance still going strong in Canada

- Harvest Crafts for Kids

Happy Bank Holiday!! 🥕🥬🍅 Get yourself some delicious local and seasonal produce from our farm shop, just like these fantastic carrots. Not only do they look and taste amazing, but they also stay fresh longer too! #littleheathfarmshop #littleheathfarm #dunhammassey #altrincham #manchester #southmanchester #farmshop #buylocal #shoplocal - @littleheathfarmshop on Instagram

- *Camp Run-a-Muk: An All-girl Mystery Game

- Autumn Harvest...

- 50th Birthday jungle theme

Caleb being eaten by paintes serpent cucumber - @comanchecreekfarms on Instagram

- Tso chicken

What an AMAZING market today... it was our biggest one of the season.😊 . We couldn’t have pulled it off without our amazing volunteers, neighbours and customers...thank you! 💚 . Our tireless volunteers came early to help set up the market, work with Kelly to serve customers and also helped to harvest extra produce as needed. We are so grateful for their time and help! 😍 . Also a huge THANK YOU to our neighbour Katy for sharing her delicious curried callaloo with staff and volunteers (last two pics). 😋Was so nice to have something warm and rich after a hard day’s work! . . . #freshproducemarkethamilton #urbanfarminghamilton #easthamilton #organicfarminghamilton #weloveourvolunteers #weloveourcustomers #weloveourneighbors #curriedcallaloo - @mcquestenurbanfarm on Instagram

- Our Familys Other Farms

- Charleston Farmers Market

- Macaroni Crafts

- Community Supported Agriculture

▫️ What you see is the fresh produce that arrives in a convenient box at your door. Heres what we see! A team full of people working hard behind the scenes to ensure you receive your order on time, every time. 😎 Were proud to keep our community healthy from the heart of the MD Provodores warehouse!⁠ .⁠ #mdprovodores - @mdprovodores on Instagram

What we’ve been up to on the farm in the last week: Harvesting snd washing carrots as quickly as we can! Harvesting sweet potatoes (curing now, will be available soon!). Harvesting some beautiful fall arugula and salad mix. #mofgacertifiedorganic #fallproduce #rainbowcarrots #sweetpotatoes #arugula - @twofarmersfarm on Instagram

- Farmers market adventures! First local strawberries of the year (for me at least, this is the first time I can afford them)

- Board Games

- How do you keep 25 gallons of homebrew chilled and serve it over a 4 day camping trip in 90+ degree heat?

- companys coming

- Pumpkin Harvest Day

- Backyard ideas

MassDOT is pleased to announce #farmersmarkets at the I-90 east and westbound service plazas in #Charlton on Saturdays and Sundays between the hours of 9 a.m. and 4 p.m. (Photo from Fall 2019) - @massdot on Instagram

Did ya’ll know our 8 YEAR anniversary just passed!? On September 16th 2012, Farm Cart Organics was officially born! Thanks for supporting local – we wouldn’t be where we currently are without community members like yourselves! Cheers to the next 8 years! Now, let’s go eat some fricken veggies!! 🧡🧡🧡 Peep our story for the full interview with Katie & Jason!! - @farmcartorganics on Instagram

- Strawbob Haypants

Tonights the night to spend under the stars shopping, eating, drinking and soaking in our Temecula community at the @StarlightBazaar from 5-10PM! @InTheLoopTemecula has curated over 20 local artisans, makers and small businesses to set up shop under our market lights, while our @VailHQ shops and restaurants will open their doors for the evening and the train will be toting families all over our grounds, its sure to be nothing short of magical! ✨⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #shoplocal⠀⠀⠀⠀⠀⠀⠀⠀⠀ #familyfriendly⠀⠀⠀⠀⠀⠀⠀⠀⠀ #vailhq - @vailhq on Instagram

- Football party games

- Camp Bestival 2016 - Outer Space

Some lovely fall colors in our organic orchard #nysapples #certifiedorganic #eatlocal - @breezyhillorchard on Instagram

- adult fun

- I love the garden in autumn!

- The natural colours of carrots

- Bonfire party ideas

Our good friends @thelindseyway doing whatever it takes to get their @mossyoakbiologic plots up and growing in a drought. How’s the rain been in your area? #plantbiologic #farmingforwildlife #gamekeepers - @mossyoakbiologic on Instagram

- Butterflies

- Yellow chili peppers

- Wild Wild West

- Racing Games For Kids

- This acorn‐shaped pumpkin we picked up from our local patch.

- Barn Quilt

Gluten-free multicoloured artisan pasta😋 Crystal Palace Farmers Market 10am-3pm every Saturday #glutenfree #crystalpalace #pasta #artisan - @pastadigrazia on Instagram

- Disfraces

- bday party

- A big harvest of spaghetti squash, watermelons, delicata, butternut squash, corn, and pumpkins!

- Best of Bridge Holiday Classics

- I cant wait to continue to enjoy my garden bounty into the winter!

- @rodriguezbros.ranch on Instagram

- Huge banana plants growing here in Finland. Its currently snowing outside

- Permaculture Design Course

- Sibling costume

Parents, did you know? Kids who get to experience where their veggies come from are 4,587 times more likely to eat veggies! The number’s made-up (it’s probably higher than that) but THIS is true: we are offering a new series of Adventures for Kids on Wednesdays and Thursdays this fall, starting next week. Gather a pod of your friends or neighbors, and join us! Link in profile. #farmkids #mainefarms #gokennebunks #getoutside #getdirty - @frinklepodfarm on Instagram

- Fava bean harvest. I was hoping for more but not bad.

- FARM ART

The Origin family farm was honoured to host the @bandedpeak_brewing team to show them our busy harvest operation and meet the farmers of Origin! They are great malt customers of ours, and this was an excellent opportunity to bring them to the field and show the care, precision and passion we put into our Malt Barley. . . . . #singleorigin #albertagrown #albertamalt #originmalting #farmtoglass #localfarm #pioneers #albertabarley #craftmalt #albertabeer #highquality #graintoglass #farmtocan #malt #familyfarm #maltbarley #albertabarley #albertacrafted #brewlocal #craftmalt #craftbeer #makeitgrain #local #farmtotable #localgrains #alberta #barley #abmalt #agriculture #farmer #maltster - @originmaltingco on Instagram

🇮🇹Grande sessione di Foraging durante il 17^ corso intermedio di Sopravvivenza e Bushcraft tenutosi in questo fine settimana...Porcini, mele selvatiche, piantaggine,tarassaco ,rosa canina e infuso di abete bianco. Non poteva andare meglio di così! 🇬🇧Great foraging session in 17th intermediate Survival and Bushcraft course held this weekend. Porcini mushrooms,wild apple,plantain,dendelion,rose hips and silver fir infusion. It couldnt get any better! 🌿🌾🌺🌲🌳🐕🐇🐾🍄🍎 #survival #sopravvivenza #bushcraft #bushpeople #natura #mothernature #getoutside #getoutdoors #outdooractivities #foraging #differentweekend #knowledge #instructorlife #learning #friendship #intheforest #food #campcooking #campfire #wildernessculture #wildweek #staywild #lifestyle - @cimoneoutdoorbushcraftsurvival on Instagram

- Cowboy and Indian Party theme

Take a rest😌 #שבתשלום - @baraks_berries on Instagram

- Dads huge onions harvest!! Great crop considering these were hailed on pretty badly.

All the brewers are here. Are you? Tickets available at the door, so you have no excuse... - @tncraftbrewersguild on Instagram

- Autumn

- Aeroponics

- Immergut Festival 2015

- Allotment Dreams

- Tailgating

- Harvest continues - haven’t bought food in months.

- Onions

- Beer Love

For todays #tbt we would like to share one of our favorite recent images. Everything is a 100% CGI + Post! This project was developed on partership with @opusmultipla and @cortevabr :D #architecturalvisualization #architecture #instarender #cgi #archiviz #bestoftheday #visualization #desing #decor #coronarenderer #KeepGrowing #work #art #digitalart - @abruzzoestudio on Instagram

- Pair halloween costumes

2020, secondo giorno di scuola! Continuano le divertenti (e speciali) giornate di inizio anno alla Scuola Primaria di Clusone con @origamiclusone Che meraviglia se fosse sempre una scuola fuori!!! #sipuofare #primogiornodiscuola #didatticaoutdoor #outdoor #scuolaprimariaclusone #clusone #cooperativaorigami #cooperativaorigamiclusone #origami #looseparts #soledicorde #educazioneinnatura #educazioneoutdoor #environmentaleducation #outdooreducation #educazioneambientale - @civica_mente on Instagram

🍇 HARVEST DAY! 🍇 Another year in the books maintaining Manitobas first commercial vineyard in history. The 10 varieties of grapes all finish their season around the first frost of the year, and are picked clean by our staff and some lovely volunteers. We are all exhausted, but looking forward for you to taste our 2020 Manitoba grape wines. 🥂 - @shrugdoc on Instagram

- I grew karma, give vegetables plz

- Barn Party

- Experiential Events

- Dad with pumpkin and squash harvest (PNW) 🎃🎃🎃 #HARVEST

- Tailgating

- Canning / Preserving Recipes

- barn entertaining

- Delicious Desserts

- Small harvest of purple hull peas

- Move along.. Nothing to see here...

- birthday ideas for friends

- Ive Done This Twice A Week For Almost 2 Months So Far!

- Bbq baby shower

- Vine Design

Here is our crew so far!!! We finally all had a chance to get together last night and toast to summer...and our new sign!! A few of us will be around the garden today if you want to stop by for a little tour. It’s a beautiful day! Enjoy 😊🌸☀️ - @naramatapermaculturefarmgarden on Instagram

- Eco Top Chef

Mise en place for Vegetarian Satay. -Can be skewed or grilled. -Best served with peanut sauce -Origin- Indonesia Follow @eatables___ #eatables___ - @calcuttafoodiegirl on Instagram

- Hayrides!!!

Harvesting amaranth for drying #jellomoldfarm #swgmc - @jellomoldfarm on Instagram

No such thing as an ugly tomato! No such thing as ugly if you want to go there too 😌 @unsqgreenmarket tomorrow on the East Side. See you there - @bodhitreefarm on Instagram

- Tomato Garden...

- Of all the things I love about gardening, drying and braiding onions and garlic is the tops. It is so satisfying.

- back yard fun

- Apple of my Eye Party

- Lei

Our Pumpkin crop is coming along nicely 🎃 Tickets on sale now (Link in bio) - @tulleyspyopumpkins on Instagram

Autumn has arrived, you know what that means...harvest season! 😁 Take a look at these monster squashes grown at @gorsefarm_ie - almost couldnt get a wheelbarrow big enough! 🎃 Pick up their produce at their Honesty Box (Y21 R836) or visit gorsefarm.ie for a list of their stockists. #TasteWexford 💜💛 #SupportLocal #ShopLocal #LocalProduce #HomeGrown #WexfordTogether - @tastewexford on Instagram

- Safari Food

Fresh beans are back ✋ green bluelake beans, purple beans, yellow wax beans and dragon tongue beans - @black_sheep_farms2013 on Instagram

- Enjoying the fruits of my labor

- Flea market new to sell

- #foodisfree

- Baby Shower Ideas

For next weeks Katchkie Farm Virtual Family Cooking Class, well be making a hearty roasted root vegetable medley with a garlicky yogurt sauce using fall favorites such as beets, carrots, potatoes, butternut squash, and fennel. Well be serving it up with a mixed lettuce salad with a raspberry vinaigrette, topped with a mustard flower garnish! If local, pick up your kit Tuesdays from 4:30 - 5:30pm at the entrance to Katchkie farm, 745 Fischer Rd., Kinderhook, NY 12106. We ask for a suggested minimum donation of $12 for our recipe kits, but any amount you can contribute is greatly appreciated. Tune into the virtual class on Wednesday, October 7th from 5 - 6:30pm. Please fill out the Virtual Family Cooking Class interest form. Link in bio! . . . . . #thesylviacenter #sylviacenter #virtualcooking #cooktogether #cookwithus #healthy #farmfresh #recipe #virtuallearning #columbiacounty #newyork - @sylviacenter on Instagram

- Birthdays

- I so badly wanted one of these tails.... I wore it for an hour and then never again.

- hmmm

- Bizzare things

- Tied

Escabetx d’hivern silvestre - @fransburken on Instagram

- campfire party

- Purple Garlic from Pedroñeras

- Autumn

- Fun #FamilyFirst Activities

Our produce stand is ready for this weekend!! . #freshproduce #pumpkinfarm #Fallseason - @benjamintreefarm on Instagram

- These massive chonkin vegetables

- Zucchini Blossoms

Summers over, folks! Time for fun fall flying! This is quite a few years back at McGeehees catfish resturant in Marietta, OK. I cant find the overhead shot, but we had a lot of planes packed in there!⁠ ⁠ ⁠ #mcgeehees⁠ #supercub⁠ #supercubbin⁠ #aviationdaily - @supercubdude on Instagram

- 722lb Giant pumpkin seed update. Details in comment.

Its not so hard to eat your veggies when they look this good. See you tomorrow, bright and early! - @oldtownfarmersmarketalx on Instagram

- Canning & Freezing

- First Year Market Gardening Retrospective

- It’s the mirabelle season in the Lorraine region, France. They taste so good!

- Some weird kid at school keeps leaving fruit in my locker. What the hell is this and where did he get it?

- Carnival Fun & Games

Instagram ticket giveaway winner...in August, during The Great Vermont Picnic, we encouraged participants to snap a photo of their picnic and post to Instagram with the #vermontpicnic hashtag for a chance to win tickets.   Tickets to what??? Next year is our 25th anniversary!   Our organization has been around since 1996 and next summer we’ll celebrate. Certainly we don’t know what that will look like yet, but we’re hoping it can be quite the gala. Whatever it looks like, shall we see who is going to join us? ...and the winner is @alyssarrrose - congratulations! Thank you for taking part in The Great Vermont Picnic this summer. Stay tuned for our plans! Until then, we continue to collaborate with our members and statewide partners on a range of projects. Throughout the month of August we ran The Great Vermont Picnic. Folks were invited to celebrate the farmer-chef connection by ordering takeout and pairing the meal with a local beverage and other choice VT products. The thought was to support our state’s restaurants, farms, and specialty food & beverage producers in a safe and fun way. It was a creative alternative to our Annual Forum Dinner that normally draws 650 people to Shelburne Farms in early August to celebrate our members. Support our work on GoFundMe - link in bio. #vfneats #vfndrinks #diginvt #vermontchefs #vermontfarmers #farmerchef #august2020 - @vtfreshnet on Instagram

Words cant describe the love I have for this beautiful bunch of motley farmers 🚜🌱 What an affirming time its been, living here through this period of global upheaval, feeling more connected, in love with life and FULL of fresh organic food than ever before 💕 If I ever had any doubt that this way of living improves resiliance, stability and sustainability in the face of political, social or ecological unrest .... I sure as heck dont now!! Permaculture; people care, earth care, fair share. That is a future I look forward to with all my heart 💚💚💚 #permaculture #regenerativeagriculture #love - @harrietofearth on Instagram

- Backyard

- Farm themed party

- Todays Harvest, mostly intentional. Organic, just not certifiably so.

- Grew a 705lb pumpkin this season, not bad for oklahoma.

- Thats it for my vegetable patch this year, except for the kale. Its going to freeze tonight.

- Fall

Beautiful afternoon to be picking Tomatoes.🍅 - @nycorngrower on Instagram

Office today. #smokeandroast #grillmaster #party #work - @franks_film_catering on Instagram

Big ups to our amazing kupuna distribution team and all the hard working Hāna farmers. These bags feel like they’re full of bowling balls, but no! Just choke organic farm fruits and veggies on their way to Ke‘anae ‘ohana, curiosity of @tourmaui. Mahalo for your kokua. 🙏🤲🤙 #hanafarmersmarket #staysafemaui #kupunacare #hānastrong #eatlocal #sustainableliving - @hana_farmers_market on Instagram

- 127 worlds Longest Yard Sale

- Barbeque

- Bubble Goth

- Turkey Birthday Party!

- A very pretty harvest yesterday

Available right now at your local market. #daylesford #supportlocal #markets #farmersmarket - @daylesford_sunday_market on Instagram

- An display of olives in Isreal c.2019

- First time getting a harvest of carrots with more straight ones (left) then forked/crooked ones (right)!! Also purple carrots in the back.

- “Yeah, let’s just stand right here while everyone else is sitting down.”

Clean and healthy food from our farm to your table. #carolinianvalleyfarm #libertycommon #constantinetoronto #lapalette #bymark #maisonselby #aubergedupommier #canoe #ardorestaurant #ontariofarmers #farmtotable - @carolinianvalleyfarm on Instagram

- Rainbow carrots.

- Bartender

Did you know almost 70% of all potatoes are stored for later processing. Temperature and moisture regulation are very important to produce the best taste of the land. This takes place with the greatest care by our farmers. Thanks! #farmfrites #storage #potato #potatoes #harvest #photo #photoftheday #fries #food #yield #process #besttasteoftheland - @farmfritesinternational on Instagram

⭐ The day is almost here! Our 2020 Fall Flash Sale is 3 days away! 🎃 Dont miss out on our iconic corn maze, fun-filled attractions, and more! Take advantage of the LOWEST PRICES of the season! Visit the link in our bio to learn more! - @fritzlerfarmpark on Instagram

- Dreaming of harvest time

- Our yearly harvest picture!

- Door County

🎃 Our fall festival kick off weekend went amazing! We had pumpkin launching, hay rides, bonfires and tasty fall food. We also had our famous parade of machines through the park! If you missed Diggerfest this past weekend, reserve tickets for next weekend. #diggerlandusa --- Check out Diggerfest = https://bit.ly/3kGr3hK (or check for links in our bio) --- #diggerland #amusementpark #driveridesoakslide #southjersey #southjerseyfun #njmom #njmomblogger #njblogger #amusementparks #themeparks #funforkids #njfamily #travelingwithkids #njparents #nycparents #njtripideas #watermain #funforkids #familyfunday #familyfun #thingstodonj #familytravel #newjersey #nyckids #visitsouthjersey #thingstodowithkids - @diggerlandusa on Instagram

East Clintons FFA Officer Team with a new 8RX from our Washington Court House location! . . . #agpro #agproco #strongonservice #equippedforanything #johndeere #johndeeregreen #deere #deeresighting #nothingrunslikeadeere #drivegreen #ffa #farm #farms #farmer #farming #ag #agriculture #equipment #farmequipment #tractor #tractors #farmlife #americanfarmer #new #tracks #johndeeretractor - @agproco on Instagram

- Culinary -koreniny...

- 21lbs of corn, 2/3 of my carrot crop and a couple days worth of zucchini and cucumber! SoCal desert suburb garden.

- Community Supported Agriculture

- Harvest Party Games

- Finally some goodness from 2020

- A day after the climate strike, it’s the first Sikh guru’s 550th birthday, and the Surrey BC Sikh community got together to plant 550 trees in a local park. Our holy scripture talks a lot about the environment and I’m glad they’re helping.

Labor Of Love (LOL) Weekend! Enjoy your long Labor Day weekend and celebrate the ‘fruits’ of our Labor by preserving some for the winter! What a great time to come together with friends and family and can, jam freeze or dehydrate and then enjoy the taste of summer all winter long! - @mortonsorganicorchards on Instagram

- Give Thanks

- Old fashioned Apple cider press

- Almacenamiento de comida

- Shrimp and crab boil

- ! Kitchen Kapers

- Construction party

- Garlic Ideas ;)

- Amelias first birthday

- Grew a lot of different types of tomatoes this year. Some of my favorites are garden peach, chocolate pear, white cherry, green Moldovan, green zebra, and Amy’s apricot.

Fog BY CARL SANDBURG The fog comes on little cat feet. It sits looking over harbor and city on silent haunches and then moves on. - @turnersfreshmarket on Instagram

- {Artisphere Street Scenes}

- Happy BIRTHDAY Golden

- rammed earth wall

- Aint Nothin Like A CookOut

- Good potato crop

Dagens skörd efter några timmar i skogen och husknuten! 🐝 #höst #skörda #lingon #plommon #havtorn #lingonberry #seabuckthorn #plum #scandinavia #sverige - @agnetaelmegard on Instagram

- I may have planted too many cherry tomatoes