Timelapse Profile Pics

time lapsetimenightwaitinglapseagingdayflowerearth
claudia klatschen oeklo

- art

city time lapse

Filming in the time of corona .Cinematographer Vijay Kartik Kannan on the set with A7S and Zeiss Batis minimal gear & crew, during the time of COVID lockdown. For the song Nenjame featuring in the upcoming movie Doctor. Great job. - @zeisscinematography_india on Instagram

claudia oben oeklo

Get featured use tag #hasselbladcameras #hasselblad #hasselbladporn #hasselbladcameras #mediumformat #hasselbladdaily #cameraporn #analoguecamera #classiccamera - @hasselbladcameras on Instagram

night sky spinning stars time lapse

Triopo C-158 +B-2 Top Kafalı Tripod Yaz Kampanya Fiyatı. 400 ₺ Maks. Yük. 150cm , Taşıma Kap. 4500gr , Ağırlık 1200gr , Çivili Ayak #tripod #canon #nikon #sony #ürünçekimi #portreçekimi #manzaraçekimi #triopo - @yalikavakfoto on Instagram

sonymusicentertainment sony music entertainment africa sound african recordings sar drip

- Ya vieron a la Yali triunfando en el ad de Huawei?

svirmele crazy time lapse bored

vertigo. new york city, circa october 2019 - @heisenberg.mov on Instagram

party beer vcheers opne bier

YoloBoxs touchscreen control and built-in software make one-man production way easier. Credit@stevendivish #livestreaming #videographer - @yololivtech on Instagram

sunpov sunpov meetup 13th annual sunpov meetup limbus company project moon

Behind the scenes: Filming our first Change Victoria campaign following strict guidelines in level 4 restrictions - @changevictoria_ on Instagram

harry potter text novel jk rowling novel movie series

- Camera

daily pictures 8years timelapse aging

@gofilmit using the @djiglobal OM4 connected to #filmicapps and the new #filmicpro v6.12 update for clean HDMI output AND compatibility with the entire family of @DJIglobal #smartphone stabilizers, including the brand new DJI OM4!⠀ .⠀ Learn more via the link in our bio! 👆 - @filmicapps on Instagram

mortal kombat fatality fatality mortal kombat

Shooting Jarak Jauh. Kliennya preview shooting melalui Online Streaming 😁 . . Luar biasa Tim @ardytama Terima kasih mempercayakan equipmentnya di @bsmrental 🥰🥰🥰🙏🙏🙏 . #sewaatemmini #sewavideocapture #sewakamerajakarta #sewalumixs1 #sewalumixs1h #sewalighting #sewalightingjakarta #sewajasastreaming #sewalatstreaming - @bsmrental on Instagram

chechnya war war footage

Vertical Frame GoPro HERO 8✅ Il miglior accessori per la tua GoPro✅ Vertical Frames avaiable at www.go-drone.it Made in Italy 🇮🇹 #gopro #goprohero7 #goprohero7black #goproit #goprohero5 #goprolife #goprodoubleframe #goproverticalframe #goproaccessories #gopro3d #goprokit #gopro_captures #3dprinting #verticalframe #goproit #goproitalia #kitesurf #goprofamily #goproaccessories #hero8 #goprophotography #gopro8 #gopromax #stabby #godrone - @godrone__ on Instagram

taichanbm taichan pekanbaru bang mali taichan bang mali persada radio

- @odjatl on Instagram

bloom flower nature timelapse cool

10mm for the win! ;)🎥🤙 #alexamini #ultraprime #teradek #wcu4 #10mmportrait - @maxvalsan on Instagram

whiteyy18 obw

Come join us Sunday, March 1, in downtown LA at Parabolix Studios for our 2020 Lighting Meetup kickoff! We’ll be showcasing new products, lighting Q&A, and shooting with all the gear! RSVP: info@parabolixlight.com Bring your camera! #parabolixlight.com #lightshapers #lightingmeetup - @parabolixstudios on Instagram

tokyo japan tokyo tower tower time lapse

Hai provato ad essere disegno, pittura e scultura. Non ha funzionato. ******************************************** TI PROGETTO, MENTRE RIPOSI. ➡➡➡ SEI VIVA, SEI VIVO. [🔊sound on] - @phil.arkv on Instagram

workout herbalife herbalife nutrition healthy active lifestyle get active now

Our astronaut👩‍🚀 will take the Beta95x to space 🚀!!! // // #betafpv #beta95x #beta95xgopro6 #beta95xv2 #insta360go #insta360 #cinewhoop #cinematography #fpv #fpvattitude #fpvlife #fpvdrone #fpvaddiction #cinematographer #fpvpilot #fpvracer #droneshots #droneoftheday #dronefly #getfpv #rotorriot #tbs - @betafpv_theaxiao on Instagram

timelapse

Ik Supna ❤️❤️ @singga_official - @hunnysinghrolls on Instagram

i have an idea sticker oka idea aalochana idea

vivo X50 Pro = Professional photography condensed into just 182g. In short, it is well designed, conveniently portable, and equipped with powerful photography functions. 📷📷👍👍 - - #vivo  #X50Pro #PhotographyRedefined #XClassDesign - @vivo_global on Instagram

andrew moore andrew moore

3d printing taken to another level😄 - #python #electronics #coding #coder #devlife #learntocode #tech #technology #geek #coding #science #computerprogramming #embedded #industry4 #programming #code #developer #IoT #internetofthings #3dprinting #dreamerpro #flashforge - @dhiraj_gehlot on Instagram

kuwait national day %D8%A7%D9%84%D9%83%D9%88%D9%8A%D8%AA happy kuwait national day happy national day kuwait

- @kaiquebritosantos_ on Instagram

jj divided jj watching buildings timelapse

Behind the scenes commercial video with BlackMagic 6k . . #behindthescenes #blackmagic6k #filmmaker #filmmaking #dubai #cinematography #filmphotography #bts #filmmakers #film - @awesomeemirati on Instagram

teary eyed leda caruso the lost daughter sad unhappy

New shipment arrives today! After backorders are filled, limited quantities are available. “If you ain’t first, you’re last!” Race to checkout starts now! . . . . #btparts #bruggerandthomet #stockup #hecklerandkoch #APC - @bt_parts.com_ on Instagram

lithops flower bloom yellow beautiful flower

RED Ranger Helium 8K S35 + Angenieux 25-250mm + O’Connor 2575D 🔭 #Sniper - @richysnap on Instagram

safe kay faze clan faze faze kay

Just a few @kupogriptw lighting stands.... and a 12’ x 12mm’ Scrim 😍 Photos and set by @aaronandersonvisuals Need stands, clamps, booms, grips, suction for your gear? Think PROtog and Kupo. ————————————————— Shop online www.protog.com.au Search Kupo on our website for a very extensive range. Protog - 17 McKeon Rd, Mitcham 3132 ————————————————— #protog #gear #photographygear #cars #kupogrip #carvideo #visitmelbourne #visitsydney #perth #queensland #batteries #battery #powerex #canonaustralia #sonyaustralia #nikonaustralia #fujixaus #nanlite #artisanandartist #camerabag #nanlite #tripod - @teamprotog on Instagram

time lapse kimi no na wa your name anime manga

- U.S. Homeland Security

reilly brown outrage gif outrage web toon comic

Hoy es el día de descuentos especiales!!! Con @ringuniverso estamos haciendo súper descuentos y promociones! Entrá a la tienda virtual https://ringuniverso.mitiendanube.com elegí el o los productos que quieras y por estos días súmale a todos los descuentos un 10% de descuento extra utilizando el código cupón descuento PRODUCTORATV - @lisandrocarret on Instagram

flower blooming cactus time lapse

Nice combination of Leofoto photography accessories (LM324CL &LB-75S & G2) photography by Stian Rognhaugen - @leofoto.cn on Instagram

yeah

Noch 6 Tage läuft das Sommerprojekt 2020! Deine Kreativität kannst Du also noch zeigen! Die Rubner Gruppe sucht nämlich nach frischen Ideen für ein Imagefilm-Konzept! . Du weißt, wie man den Rohstoff Holz so richtig toll in Szene setzen kann? 👉Link in Bio👈 . Und gewinne dabei noch richtig tolle Preise!! 🏆🏆 . Fuel your future: Dein Sommerprojekt 2020 . . . . #fuelyourfuture #passion #imagefilm #konzept #ideen #sommerprojekt #deinsommerprojekt #südtirol #karrierestart - @karrieresuedtirol on Instagram

time lapse

Set on set #kano - @iam_johnadams on Instagram

okay ok okk text textart

I’m GIVING AWAY 9 of the new @GoProANZ #HERO9Black camera’s TODAY! To enter - Just comment below what your favourite new feature is on the camera and what sport or adventure you’re going to capture with it. I’ll pick a winner every hour starting at 9am Today. Good luck! These new cameras are Mental !!! - @markmathewssurf on Instagram

aquamarine time lapse magazines

Any techniques for making those low down shots? Share a solid setup by @paul_dolden_details - @desview on Instagram

saturday glitch gif supreme vhs

Its lit...with these profoto lights or natural light at Stitch Studio. Book now! . . . . . #nyphotographer #pursuitofportraits #profoto #studiorentalnyc #nycreatives #brooklyncreatives #nycreatives - @stitchstudiosbk on Instagram

rajkumar patra manab bengali actors style action

The immaculate and new Rodenstock HR Digaron-SW 90mm f/5.6 lens for the @phaseonephoto XT. Discover the newest lens in the Phase One XT family and pre-order at the link in our bio. . . . . . #seekextraordinary #phaseoneinfinity #digitaltransitions #mediumformat #digitaltransitionsphoto #phaseonephoto #phaseonext #landscape #architecture @phasonext #diagonal_symmetry #art_chitecture_ #tv_leadinglines #rustlord_archdesign #srs_buildings #ptk_architecture #archi_features - @digitaltransitions on Instagram

hva hogeschool van amsterdam hogeschool amsterdam university of applied sciences auas

September 15, 2020. New toys at work... 👀🔥💯 #daily #x100t #monochrome #BMPCC4K - @ryanbelk on Instagram

paris light trail photography time lapse skyline night city view

Blessed with another clear evening tonight. Elephant Trunk on target and beta testing @zwoasi Asiair Pro v1.5. The new autofocus with EAF will be a game changer, along with everything else this astro-automation product has provided. #OPTeam #astrophotography - @drewjevans on Instagram

yoshi

A brilliant way to show off your #filmmkrs workplace with BTS by @oltjp 😍💯🎥 - @filmmkrs on Instagram

cat cats speed up timelapse time lapse

Job de hoje!!! Hoje é sexta-feira!!!! - @noda_eng on Instagram

gibi y%C4%B1lmaz ilkkan ersoy feyyaz yi%C4%9Fit

#thx #fiioq3 #newproduct #newproducts Compared with the last generation,the Q3 comes with an extra 4.4mm balanced output. 3 mainstream headphone outputs, 4.4mm2.5mm/3.5mm/4.4mm jacks, allow you to connect all kinds of headphones. So you dont have to sacrifice compatibility with single-ended headphones while having fun with the balanced output! - @fiioofficial on Instagram

goodnight moon set moon field pretty

At Elemental, we believe fiercely in the power and value of exercise as a means to a better quality of life. We are committed to providing our members with optimal health and fitness experience. Utilizing a state of the art, patented technology know as @airphxcompanies - we are able to provide continuous disinfection treatment of the surfaces and the air in our facility. Head over to our FB page for more info and links to the airPHX website. #elementalperformancefitness #elementalperformanceandfitness #lmntl #everydayathlete #landerwy #cleangym #airphx - @elemental_performancefitness on Instagram

hcy

Slaviero Essential Victória - @wrocio on Instagram

alexboya draw time timelapse

Think filmmaking think Moza Air Cross2 ! . This lightweight gimbal offers compatibility to most* modern DSLR and mirrorless cameras and a host of innovative features to help you realise your dream shots 😊 --------‐----------------------------------------------------------- ⁣⁣ ⁣⁣Use #ReliablePhoto to get featured ⁣⁣ ⁣⁣--------‐----------------------------------------------------------- ⁣⁣ ⁣⁣Improve your skill set #LearnWithReliable ⁣⁣ ⁣⁣--------‐----------------------------------------------------------- ⁣⁣ ⁣⁣#iwantthis #camerastore #videogear #camerasetup #cameraaccessories #cameralove #videography #cameragear #mygear #placeforcreators #create #camera #newtechnology #camerashop #gudsenmozaindia #mozaaircross2 #gudsenmoza #mozagimbals #mozausers #moza #camerastabilizer #videography #gudsen #filmmaking #filmmaker #aircross2 #instagood #instadaily #coolgadget - @reliable_photo on Instagram

sushi cute food japan relaxed

Legendary shoot DPing with 2 @reddigitalcinema Komodos and @the.peoples.collective crew. @spritzcam came in clutch with the #rayrig and @djiglobal #ronin2 for the @ferrari rolling shots through DTLA & @steadicamjazz rolled through and blessed us with some sauce 🎥🦾. Thanks to Director @only1eq for once again having me out and trusting my vision and to everyone else who helped make this day to remember happen. Definitely one for the books 🔥🙏... ******** SWIPE FOR SOME SNEEK PEAkS 🤫 ******** #cinematography #behindthescenes #directorofphotography #hiphop #musicvideo #cameracar #djironin2 #steadicam #ferrari #rollingshots #redkomodo #grateful @spikeleek @drakecummings @@spritzcam @only1eq @e_bartos_ @purpledragon24 - @mmsvisualsolutions on Instagram

animation movie music collage

@lochbihlerjan Sportschiessen, Gewehr 50m @minsk2019by #minsk #minsk2019 #minsk2019by #minsk19 #belarus #eg #eg2019 #europeangames #europeangames2019 #2ndeuropeangames #europeangamesminsk #dinamostadium @stadium_dinamo #swissolympic #swissolympicteam for @swissolympicteam via @keystone - @dominicbruegger.ch on Instagram

amused show laugh broad smile great time

Now current situation of Raigarh districts some places. Pachdhari, pahad mandir(Raigarh) and kali mandir(Sarangarh) Pc:- @manaswi14.__ Follow us :- @__.lostinworld.__ . . . . . . . #rain #raining #rainyday #pouring #rainydays #water #clouds #cloudy #photooftheday #puddle #umbrella #instagood #gloomy #rainyweather #rainydayz #splash #TFLers #downpour #instarain #rains - @___lost_in_nature__ on Instagram

marc wait too long time

Nodal Ninja photo contest is coming. Want to win our latest MECHA dual axis with NN3 MK3 and Nadir Adapter? $599.95 value. #WinNodalNinja - @nodalninja on Instagram

Une image éclatante de détails. Avec la technologie MINI LED du téléviseur X10, les noirs les plus profonds comme  les blancs les plus purs se révèleront sous vos yeux ☁️ #TCL #TCLMoments #TCLNews - @tclfrance on Instagram

skywing anteria speke nationstates

@american_civilian ・・・ PRISON MIKE & SUPPRESSED BOLT GUN 😤 #issavibe @vortexoptics . . . . . . . #longrangeshooting #precisionrifle #longrange #pewpew #shooting #hunting #rifle #guns #longrangehunting #sniper #a #gunsofinstagram #gunsdaily #ar #rifles #creedmoor #precisionshooting #pewpewlife #gun #vortexoptics #boltgun #firearms #shootingrange #boltaction #longrangerifle - @triadtactical on Instagram

goe nr gwaves red goe rain time

Check it out 🥾 #Repost @deeluxeboots_japan with @make_repost ・・・ シンプルかつオリジナリティのあるデザインを追求し続けるスニーカーブランド[AREth]とのコラボ第二弾‼️ パウダーで気持ちの良いターンが出来るようにしなやかで柔らか過ぎない絶妙なフレックスに設計 @areth_foot_wear @yonefilm - @yonefilm on Instagram

grow up time lapse grow age meme

- hmmm

downsign username handle official verified

Coming soon! #newproductlaunch @aputureindia @aputure.lighting The Accent B7c is the ultimate light bulb for filmmaking: a battery-powered RGBWWW color-mixing practical LED lighting fixture that combines a unique set of features that no other luminaire has. Flicker-Free Filmmaking. 💡 Impeccable Color Rendition. 💡 On-board Brightness & CCT Control. 💡 . . #flimmaker #punefilminstitute #punefilmmakers #punecinematographer #punecinematographers #punephotographers #productphotography #punefoodie #puneblogger #puneinstagrammers #puneinfluencer #puneinsta #puneshortfilmmakers #aputurebulb #newproductlaunch #newproductalert - @photographystorepune on Instagram

time lapse time lapse growth time lapse vegetation our planet our planet forests

Получили новые насадки на #aputure300dii - #aputurelantern и #aputurespotlightmount - @uleyrental on Instagram

facebook twitter instagram zuckerberg dorsey

- Cake Decorating Videos

making bed time lapse

On Wednesday’s we drone ... - @rvlvrlabs on Instagram

facebook twitter instagram zuckerberg dorsey

Some views at work are better then others 🌅 - @lassindigital on Instagram

sabrina soto time lapse table

Chegou nova Profoto B10 Plus 500w Tocha com flash 500w Led dimerizável e com equilíbrio de cor. Excelente também para seus vídeos. Acompanha novo Radio Connect, faça tudo pelo seu celular. A tocha funciona tanto na bateria quanto conectado à tomada. Contamos também com todos os acessórios da linha OCF Experimente! - @raineriequipamentos on Instagram

amelia watson hololive walfie

IT’S HERE!!! Super excited to try out my new underwater rig with the @sonyalpha A7Riii, @seafrogs.com.hk housing, and @lightandmotiondive Sola 2500 lights! Now comes the scary part of getting it all in the water for the first time 😝 .⁣ .⁣ .⁣ .⁣ .⁣ #lightandmotion #ocean #sealife #underwater #diving #adventure #freediving #uwphotography #underwaterphoto #scubadiving #underwaterphotography #naturephotography #underwaterworld #sonyphotography #travel #sonyimages #sonyalpha7riii #wanderlust #instagood #photography #photographer #sonyalpha - @limitless.pacific on Instagram

1sec one second 1second one sec

. Hey Guys! Im Back With This #Legendary #Setup This is @nikolaj_ssr s Setup 🔭📸🌌 . Setup Parts: #Skywatcher 8 F/5 #Newtonian #Skywatcher #AZ-EQ6 #Canon #EOS70D #Lacerta MGEN-II #AutoGuider . #Telescope #Night #Moon #Observing #Observatory #astrophotography #astronomy - @worlds.astrophotographers on Instagram

final fantasy tactics ffta final fantasy tactics advance gba pixel art

shoot Uk Uttarakhand DOP Bittu Gill - @dop.bittugill on Instagram

time passes by thaw project life below zero time is running day goes by

Getting close to MEGACITY BETA. If anyone wants a code beforehand send me a message. #MEGACITY #paintings #arcade #gamedev #art #cyberpunk #javascript #php #bitcoin #instagames #et #ghostjacket #a7sii #contemporaryart #release - @roscoestudio on Instagram

what what did you say hearing one more time ignored

What makes me comfortable enough to create is the people I work with. The DOP is like your best man in your wedding. By all cost he will make sure you have a good time during your wedding and keeps you on point. My brother @hossein_tc you’re that best man. 🤣 🤣. #shootfilm #shoottv #shootseries #libboy #dop #filmdirector🎬 - @iamprince.joe on Instagram

strawberry time lapse

Things change..like our Instagram username...@arrrichannel will close in August...Follow us @arri #changeisgood #followus #arri #7lessletters - @arrichannel on Instagram

naake konchem time kaavali sticker time attarintiki daredi movie i need time

#umma95  Designed by @ummagawd   Spec. GoPro Hero6  Caddx Nebula  FC&ESC Betafpv  Motor Betafpv 1105 5000kv Propeller EMAX Avan Rush 2.5inch  #cinewhoop #fpv #drone #fpvdrone #fpvlife #dronestagram #fpvaddiction #gopro #nakedgopro #fpvracing #fpvfreestyle #fpvaddict #quadcopter #dronevideo #multirotor #drones #dronephotography #fpvpilot #tinywhoop #ドローン #ドローンのある生活 #剥きプロ #betafpv #umma85 #microdrone #microfpv #CWTKY - @cinewhoop.tokyo on Instagram

red dead redemption

Now with 19mm rod support. Lomo anamorphic build requires something more than just the PL mount. Killer stability. . . . . #griprigs #keygrip #lomoanamorphic #stabilizedhead #setlife #cinematography #movingcamera #gripfactorymunich #backonthegrind #srh3 #arrisrh3 - @heavymetalgrips on Instagram

heimer big brain calculating

Download the OneTwoSmile App now through Google Play and Apple Store🤩🤩 Link in bio حمل التطبيق الان على جوجل بلاي و الأبل ستور🤩🤩 اللينك في البايو - @onetwosmiledental on Instagram

time lapse

In honor of #internationaldanceday I decided to officially announce your next dance captain, Aisha Farooqui. Aisha has always been completely committed to dance and was a complete help to the team. There was times where she stepped up as leader when I had eboard meetings.She held extra dance practices on her own time for those who needed it. She helped me create some dances or fill in some parts that I couldn’t flow right. Also a fun fact, Aisha is the only member who has never missed a practice. She also was always 30 minutes-1 hour early to them. Please give her the same respect you gave me. You all have been such a wonderful team and I can’t wait for the future. Now you must be wondering.. Kate.. are you staying on the dance team since you were elected in as Vice President ? Well I can never leave any of you behind. Aisha and I had a chat and we decided that I still will be around as one of your captains. your (ad)vice captain 😚😚so nope i’m not going anywhere😬 So congratulations to Aisha for being the next dance captain. Also congratulations to Kheon (@ke_lo.uis ) and Danny (@amadmenace ) , two of our dance members for also being now apart of 2020-2021! You guys will do amazing😉 - @aznofasu on Instagram

konchem time teesukundaama sticker time kaavaali need time lets take some time

- HOW TO repel unwanted critters in Wilmington yards

mushroom time lapse

برای اطلاع از قیمت و نحوه سفارش و خرید در دایرکت پیام دهید @watercoloristco - @watercoloristco on Instagram

fotbal fortunaliga fcfastavzlin zlin proch%C3%A1zka

#Art project - I want to build a layered One X One #onexone with spray paint layers & dimensional transformations. First try on #perspex ✌🏾 let’s go people 💳💳💳 - @feder1x1 on Instagram

jonkent generative ai generated aging timelapse

Last #giveaway be sure to follow @everythingbutthecamera @camerarigz @camerarigz2 ... tag 3 people on my post and share the image on your feed!!! #cameraman #cinematography - @everythingbutthecamera on Instagram

hva hogeschool van amsterdam hogeschool amsterdam university of applied sciences auas

Presso gli appartamenti de 𝐋𝐞 𝐋𝐨𝐠𝐠𝐞 𝐏𝐚𝐫𝐦𝐚 𝐓𝐞𝐦𝐩𝐨𝐫𝐚𝐫𝐲 𝐋𝐢𝐯𝐢𝐧𝐠 cè la possibilità di noleggiare gli spazi per scatti 📸 still life 🥫 e di ambientazione anche per aziende. Qui di seguito un paio di scatti rubati sul set fotografico per prodotti alimentari. 🥫🥤🧃 Per questo servizio si ringrazia: 🌐 Sito: www.ilbrain.com 📸 Instagram: @ilbrainagency #leloggeparma #appartamenti #italy #travel #italia #holiday #love #vacation #relax #instagood #picoftheday #parma #emiliaromagna #tourism #tourist #visiting #photooftheday #design #nature #amazing #vacanza #art #travelblogger #instatravel #travelphotography #beautiful - @lelogge_parma on Instagram

aging time lapse

İhtiyacınız olandan daha fazlası! #Sennheiser #HD280PRO stüdyo kulaklığı . . . #mix #studioheadset #headset #sound #monitor #studio #soundengineer #soundengineering - @pro.sennheisertr on Instagram

tea time cathy evans married at first sight break time have a break

- Creative photography

nature water lake reflection clouds

#arri #trinity #arritrinity #arritrinityoperator - @arritrinity_turkey on Instagram

hard time halloween exausted boo! exhausted

- Raspberry Pi

injective ninjas crypto

Love the @jobyinc setup 🤙🏽 - @xkuzmoi on Instagram

mugdha chaphekar time kumkum bhagya actress rebv actress

I made a thing! I’ve got a project I’ve been working on in #unrealengine and I’ve been really wishing I had a set of @1alphatools Alpha (or Inertia) Wheels for some of the camera work... so it seemed like the perfect lockdown project! The design is based on @kinowheels Open Source Handwheels project, but with potentiometers added to adjust speed, a case I designed to 3d Print, and a 3.5mm jack which outputs PPM signal to work wirelessly with MoVI or Ronin. I’ll be putting up the shopping list, the Arduino sketch files, the STL files for the case prints, and the blueprint for UE4 integration on github, I’ll post that link soon. The whole thing comes out to about $250 in parts, 30 hours of printing, and a few hours of assembly. The code seems pretty stable, but right now I’m using UE4Duino to get a serial monitor in UE4, which won’t work on Mac. I’ll see if I can find another serial monitor plugin that works cross platform. - @boasimon on Instagram

boston time lapse

Even with productions shut down, hats off to the casting directors who are still looking at actors for future rolls. #auditions #selftape #networktv #selfquarantine #LAfilm #NMfilm #stayathome. - @markspeno on Instagram

storymaker story time storymaker agency storytelling heart

📸 Framed on Traveler Tripod ​ We can feel the soft breeze across the water as we take in this traquil photo from @martijn_kort . An inspiring point of view in a place as lovely as Amersterdam is something we never get tired of seeing! What is your favorite city to photograph? - @gitzoinspires on Instagram

beard beard time lapse time lapse men with beards guys with beards

#Repost @monghof5 (@get_repost) ・・・ Getting ready for tonights meteor shower #canon #canon7d #meteorshower #austria #darksky #longexposure #polarievixen #manfrotto #manfrottobefree #kärnten #12thaugust - @milkyway_shotz on Instagram

aditya ak selfie boy man apana bhi time aayega

New studios being used to the full this week shooting some very exciting stuff! #video #photography #setbuilding #studio #productphotography #productfilm #product #lighting #xmas #film #bts #behindthescenes - @viewpointstudiosbath on Instagram

funny

Beautiful portraits. 1, 2, or 3? Artist @mmmmonexx . Follow @artistic.globe for more🎨 . . . #drawingart #drawings #inkdrawing #draw #dailydrawing #drawing #drawingoftheday #penart #pen #drawing #pens #instadrawing - @artistic.globe on Instagram

exercising on nom cut the rope gym time training

- professional cameras

scherezade shroff city girl time lapse lapse

GRATIS online webinar over reisfotografie. Op woensdagavond 16 september organiseren Ringfoto en Degreef & Partner met medewerking van Ringfoto Focus een gratis online webinar over reisfotografie met de Leofoto carbonstatieven. Tijdens deze avond vertellen we je alles wat je wilt weten over het merk Leofoto, geven we tips over waar je op moet letten bij de aanschaf van een statief en beantwoorden we al jouw vragen gerelateerd aan Leofoto. Bovendien hebben we fotograaf Roy Poots uitgenodigd. Roy fotografeert vooral landschappen, architectuur en cityscapes. Hij werkt al een tijdje met Leofoto en geeft tips en tricks uit de praktijk. Wil jij erbij zijn? Meld je dan aan via webinar@degreef-partner.nl en ontvang de link om het webinar te volgen. Als je je hebt aangemeld, ontvang je bovendien ná het webinar een exclusieve Leofoto aanbieding! #fotografie #fotograaf #hobbyfotografie #hobbyfotograaf #hobbyfoto #welovephotography #defotospecialisten #ringfoto #poweredbyringfoto #portraitphotography #portretfotografie #natuurfotografie #blijmetdenatuur #gaeropuit #daarwordenweblijvan #hollandinbeeld #mooiholland #holland_photolovers #webinar #reisfotografie #leofoto #carbonstatieven #statieven #statief #landschappen #architectuur #cityscapes - @foto.specialisten on Instagram

irina french art art illustration nature beautiful

Its our 10th ANNIVERSARY!!! We would like to take this opportunity to thank all our customers and followers for support during the last decade. We feel extremely fortunate to remain as a brand in this ever-changing world and we hope to stay here for at least another decade. Pictures are showing a prototype stage of the first slider. Special deals coming soon...watch this space! @ditogear - @ditogear on Instagram

time waiting forever earth time lapse

Greetings from @midpond 🤙 - - - - - #fpv #drone #fpvpilot #droneracing #dronevideo #driftflix #fd #formulad #formuladrift #driftcars #driftnation #drifting #driftworks #DJI #FPV #ImpulseRC #impulsercapex #Hobbywing #BrotherHobby #Lumenier #TeamBlackSheep #crossfire #GoPro #driftmedia #livetoslide #dailydriftmedia - @uprooted.pictures on Instagram

florida sky clouds timelapse humanharvest407

Exclusive offers, discounts up to 45% Download the application now 🔥🔥🔥 - @manfrotto.imagine.more on Instagram

waiting

Check out this awesome shot from 📸: @randycinco_sagimo Give him a follow and check out more of his great work! #urban #urbanart #art #photography #urbanphotography #architecture #urbandecay #street #instagood #urbanstyle #streetstyle #city #urbanwalls #photooftheday #urban_shots #urbanscape #urbanexploration - @acratech on Instagram

holiday holiday time buas breda university of applied sciences

- Arches NP - 1971

tine

Parte de nuestros compis de viaje y kilómetros... Bien de kilómetros! 🎥🗺️🏔️🏖️ . . . . #nikon #sonyalpha7 #nortedeespaña #isladeons #galicia #asturias #cantabria #paisvasco #pirineoaragones - @nortedeespana on Instagram

pizza watch time 420 alarm graphic art

Sirui A-1005 Travel Tripod + Y-10 Ball Head . Tripod Leg Angle Adjustment Easily Converts to a Monopod Retractable Dual-Stage Center Column Twist Leg Lock System . . . Material: Aluminum Sections: 5 Min Hgt: 10.2inch Max Hgt: 42.7inch Folded Height: 14inch Weight: 1.2kg Load: 10kg . . . #sirui #siruitripod #siruisblack #siruiimaging #siruiprofessional #siruimonopod #siruiindia #siruiseries #tripod #tripodheadstand #tripodcatsofinstagram #monopod #monopods #ballhead #traveltripod #travelphotography #travelblogger #travel #photography #enthusiast #dslrphotography #mirrorlesscamera #canon #nikon #fujifilm @siruiimaging - @siruiindia on Instagram

nyc

Behind the scenes. - @k.a.t.e.s.t.o.n.e on Instagram

waiting olivia munn imagine dragons cutthroat song impatient

It’s Tee Time! Nice shoot day in the sun on a golf course with our Cobra 🐍 rig! #motioncontrol #boltmotioncontrol #filmla - @cameracontrol on Instagram

denzel crocker time lapse

Can you put a price on peace of mind? PeakDesign Cuff #findyourpeak --------‐----------------------------------------------------------- ⁣⁣ ⁣⁣Use #ReliablePhoto to get featured ⁣⁣ ⁣⁣--------‐----------------------------------------------------------- ⁣⁣ ⁣⁣Improve your skill set #LearnWithReliable ⁣⁣ ⁣⁣--------‐----------------------------------------------------------- ⁣⁣ ⁣⁣ #photography #iwantthis #camerastore #videogear #camerasetup #cameraaccessories #cameralove #camera #videography #throughthelens #lenses #cinegear #cameragear #mygear #placeforcreators #create #camera #newtechnology #camerashop #camerastores #peakdesign #peakdesigncuff #cuff #pdcuff #peakdesignstrap - @reliable_photo on Instagram

just laser arrived

Who wants to see the final product? • Go tag Canon and Nikon users and tell them about it! • 👤photo by: @daniello_productions • - @cameraaddicts_ on Instagram

pausacafe non stop time lapse clock time

- The inside of a camera lens.

time time lapse clock clock ticking time pass

👉 Its official - the PXW-FX6 👈 Available end of 2020, pre-orders open now. . . #sony #sonycinemaline #pxw #pxwfx9 #sonyfx9 #sonyfx6 #pwxfx6 #fullframe #cinematography #cinematographer #cameraman #setlife #onset #vocas #vocasnl #hilversum - @vocasnl on Instagram

earth earth timelapse

Found and collected. Thanks to @happylittletreeshhi for creating the landscape and thanks to @asherhtx for the hide. If you have a chance donate to @oscarmikewhiskey who are a nonprofit supporting veterans affected by PTSD. - @mgriggs on Instagram

tla time lapse adventure malaysia hiker hikers

“He Vuelto A Vivir” de @fran_ch.oficial 🔥 Si aún no lo has visto, puedes buscarlo en YouTube o encontrar el link directamente en su biografía. Autor y Compositor: @fran_ch.oficial Producción Musical: @jrsoul & @matto_ortiz / @artist.makers Guitarra: @jeremy.musica / @jeremy.thoomas Cuerdas: @jose.pablo1185 / @pensarmusic Dirección Video: @unfotografoenchile / @bravelandchile Cámara, montaje y edición: @carlosherreracf / @cuerdaflojaprod - @artist.makers on Instagram

time lapse waiting

Ele voltou! DJI Smart Controller a pronta entrega! - @flyprobrasil on Instagram

Ein Thema, dass alle Künstler betrifft 👉Gehörschutz auf der Bühne! Schützt eines eurer wichtigsten Instrumente, eure Ohren👂🏻sonst wird es schwer mit dem jammen. Mit unserem InEar #artist hauen wir euch die ganze Band aufs Ohr und schotten alles unnötige ab. Somit hört ihr auf der Bühne nur das, was ihr wollt! 👉Gleich bei uns reinhören und selbst testen. #audiomanufaktur #music #amartist #InEar #gehörschutz #AMFAMILY #madeingermany - @die_audiomanufaktur on Instagram

- 3ds Max tutorials

Binaural recording with Neumann KU-100 - - - - - - - #soundrecordist #neumannmicrophones #soundmixer #locationsoundrecordist #locationshoot #locationsound #binaural - @soundmixer_will on Instagram

swipe 4 the result➡️ •➖️➖️➖️➖️➖️➖️➖️➖️➖️➖➖️➖️➖️➖️➖️️➖️ ©ᴄʀᴇᴅɪᴛ📸-@zono.sann •➖️➖️➖️➖️➖️➖️➖️➖️️➖️➖️➖️➖️ ️ғᴏʟʟᴏᴡ ғᴏʀ ᴅᴀɪʟʏ ᴜᴘᴅᴀᴛᴇs️✅️ 👉@mobile_clicks______ 👉@mobile_clicks______ 👉@mobile_clicks______ 👉@mobile_clicks______ •➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️ ᴜs️️ᴇ :#mobile_clicks_____ •➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️ #mobilephotography #photography #mobilography #indiaphotosociety #photogram #photographers #india #naturephoto #indianphotography #indianphoto #photography📷 #videos #kerala #keralaphotographers #keralaphotography #keralagram #worldphotos #worldphotographersclub #nature #naturephotography #shotonphone #shotonmoment #creativephotography #instagram #instagood #creativemobilephotographys #world#world_photography_page •➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️➖️ - @mobile_clicks______ on Instagram

DISPERSION Installation Galerie V2, Charleroi 12/2019 - 01/2020 Utiliser le sensible comme vecteur de compréhension de la complexité. Laetitia Bica est une artiste contemporaine qui place la recherche au coeur de son travail. Si son propos est avant tout de « faire image », soit de donner à voir, de révéler, il est essentiel de considérer ses œuvres comme des boutures, dont chacune est la trace d’un processus créatif qui, d’hypothèses en expérimentations, questionne le rapport de l’artiste à son environnement naturel et humain. Avec DISPERSION, Laetitia Bica mène sa recherche sur les bassins miniers du Nord de la France et de la Belgique en explorant trois pistes principales : celle de l’accumulation documentaire de traces iconographiques in situ, celle- avec Corentin Spriet, chercheur à l’UGSF 1, de l’interprétation de données théoriques et expérimentales par le travail sur l’imagerie scientifique au cœur des laboratoires de TISBio 2, et celle de la création plastique, proposée comme prolongement des résultats obtenus. 1 UGSF : Unité de Glycobiologie Structurale et Fonctionnelle de l’Université de Lille 2 TISBio : Traitement du signal et de l’image pour la biologie – Université de Lille. https://tisbio.wixsite.com/tisbio - @laetitiabica on Instagram

🚨 Make sure you follow my personal account @visioncapture_ . 📸 By: @joshua_griffen SELECT & CURATED BY Founder: @VisionCapture_ -⠀ 🔌 Presets Sale: ALL Lightroom Presets are 80% OFF! Link in bio⠀ -⠀ 🎉 RULES FOR FEATURE:⠀ ➤ Must Follow us @ElitePhotogram ➤ Use our hashtag #ElitePhotogram ➤ Photo Must Be Yours! . 🔹Follow Our Partners🔹 @photographycult . ┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈⠀ People Make Memories 🥰, We Capture Them📸!! The Goal of the page is to connect talented photographers from all around the globe 🌍 to other photographers. Join our friendly community for daily does of inspiration! ┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈⠀ .⠀ .⠀ .⠀ .⠀ .⠀ . #night_owlz #ig_killerz #igtones #epicimagez #killaframez #shotz__fired #unknownperspectives #ourvisualvibes #all2epic #leagueoflenses #agameoftones #way2ill #visualambassadors #gramslayers #fatalframes #streets_vision #illgrammers #citygrammers #dof_addicts #theimaged #streetxstory #heatercentral #streetshared #rawurbanshots #nightshooters #bokehlicious #nocturnal_visionaries #bokehcity - @elitephotogram on Instagram

Meet the new HDC-P31 POV system camera, which creates the same stunning images and look, and uses the same workflow as our popular HDC3100/3500 cameras, but in a smaller and more flexible form factor. Link in bio. - @sonyprousa on Instagram

This is what @michalbarok says - The fog, lake and this setup 🔥 I love it.👊 Do you like this atmosphere? C200 & cine 18-35mm t2 & Rhino arcII & Wise & Rode promediagear tripod👊 ProMediaGear brings precisely-designed, high-quality camera accessories to the table. CNC machined in Chicago, USA, these accessories boast of an extreme build, and are aimed at catering to the requirements of professional photographers & filmmakers. Do check out our website www.promediagear.com (link in bio) for additional information and the pricing. Or you could visit our Instagram profile to shop online! Tag us or use #ProMediaGear for a chance to get featured! #behindthescenes #timelapse #promediagear #carbonfibertripod #promediatripod #canonc200 #canonczsk - @promediagear on Instagram

Simon Fujiwara, Anne Frank’s Birthday Cake - @arthurmorisset on Instagram

Today, our friend @davidfilmmaker will show you a very unique experiment. Swipe for the outcome. #super8film #8mm #8mmvintagecamera #cameratest #dop #filmconvert #filmmaker #filmmaking #cameraready #cameraoperator #camerastoday #cameracrew #cameralife #cameradept #setlife #behindthescenes #filmconvert #cameraraw #camerawork #film #flujo #cámarametrado #camerawork #filmset #filmproducer #filmmakinglife #directorofphotography #freelance #davidfilmmaker - @tarion.official on Instagram

Cada foto nasce muito antes de ser tirada, e a criatividade é algo que determina pelo mrnos 70% do sucesso em um click. BE CREATIVE!! ❤❤ Seja um fotógrafo profissional, mesmo não sabendo muito ou nada sobre fotografia. nosso curso ia te levar do extremo zero até as práticas mais avançadas se liga. 📸Curso de fotografia básico ao avançado ●Foco diferencial ●Profundidade de campo ●Imagens em movimento ●Posicionando sua câmera ●Domine a iluminação ●Perspectiva - linhas ✅E muito mais... 📃certificado de conclusão 💵Comprou mas acha que não valeu a pena? Nos te damos 7 dias de garantia basta nós enviar um e-mail e reembosamos 100% do valor da compra sem questionamentos... 👇saiba mais👇 @v_a_lentes #fotografiaearte #naturephotography #fotografía #fotografias #fotografiando #fotografia #fotografiaprofissional #fotografiadigital #fotografiabrasil #fotografiacreativa  #fotografianaturaleza #cursosdefotografia #cursosonlines #cursosdefotografía #cursosonlinecertificados #cursosonlinebrasil #cursosdefotografiaonline #cursosonlinecomcertificado #fotospelomundo #fotocelular - @v_a_lentes on Instagram

Quase tudo pronto para mais um dia de gravação. #altashoras - @serginhogroisman on Instagram

🔥🔥🔥Introducing the Godox LED light #ML60: A daylight-balanced 60W LED light source that is extremely handy in any situation where you need potent and portable light. It features high color rendering, 8 built-in FX effects, AC or batteries powered while being impressively compact to handheld and store. With such professional capabilities so conveniently at your command, now your creative potential awaits.   📌Learn more at link in bio - @godox_photo_equipment on Instagram

Fun in the sun ☀️🦩 Bobber Case for iPhone 11 Pro, Xs, X📱Floatable, mountable, life jacket case 🏊‍♀️ Photo by @tylervosburg #gopole #apple #iphone11pro #bobbercase #summer #poolside - @gopole on Instagram

An interesting lunch time in Leicester. I doubt youll see tbe result, but Im glad I was here. - @jibztv on Instagram

- Side Road

🇬🇧 Weve got some good news here at Caman! We are happy to announce that our compatibility tests on Z CAM are very good. This is the perfect opportunity to make these compact cameras even more practical and effective thanks to the Caman. 🇫🇷 Il y a du nouveau chez Caman ! Nous sommes heureux de vous annoncer que nos tests de compatibilité sur la Z CAM sont très positifs. L’occasion de rendre ces caméras compactes encore plus pratiques et performantes grâce à la Caman. . . . #zcam #zcamaccessories #zcamusers #zcamcc @zcamcc @zcamusers #cameragear #cameragears #chefoperateur #smallrig #camansystem #camanhandle #zcame2s6 #zcame2 - @caman.swiss on Instagram

- @fritzgeraldzeph on Instagram

It took some finessing but i was able to convert a source 4 leko into what I’m calling a Pro-Leko. It’s essentially a smaller, less expensive zoom spot with interchangeable lenses. 🤓 . . . #proleko #photodork #chismgrip - @brianchismphoto on Instagram

#Repost @davidfilmmaker with #pdmovieliveair2 📹📝Probably 40% of my work is still done with my Sony A6500 and with this setup. . . . #sony6500 #filmmaker #filmmaking #filmlife #filmfeed #setlife #lifeonlocation #videoproduction #videographer #filmproduction #freelance #fulltimefilmmaker #cameradept #1stac #shooting #camerasetup #davidfilmmaker #pdmovieliveair #wirelessfollowfocus #followfocus #lenscontrol #focuspuller #cameras #cameraporn #cameralens #cameragear #cameradept #cameraoperator #filmlife - @pdmovie_uk on Instagram

Drones need PFD’s too - @phluxyfpv on Instagram

Jab sapne hue sach 🙌🏻 YouTube: Gamerism ♥️ - @saanwrey on Instagram

Sirui ET-2004 Aluminum Tripod with E-20 Ball Head 1. Flip lock leg locks for fast setup and breakdown. 2. Full-sized, but folds down small. 3. Legs fold up 180° for extra compactness. 4. The center column can be inverted for low angle shots. . . . Max Height: 57″ Min Height: 5″ Folded Length: 17″ Leg Sections: 4 Weight: 2 kg Load Capacity:12kg . . . . . #sirui #siruitripod #siruiindia #siruiimaging #tripod #tripodheadstand #tripodphotography #photography #equipments #equipment #cameragear #kamera #gear #allinone #stabilizer #dslr #nikon #photooftheday #cameraequipment #tripodgear #gorillatripod #canon #follow #instapost #accessories #accessoriesforcamera - @siruiindia on Instagram

- Car DVR

¡El mejor gimbal para usar con una mano! #ronins #DJIStoreCR - @dji_store_cr on Instagram

Here is our next giveaway! Win a #Profoto A1 . . To participate 1. Follow @vjsdpl & @srishtidigilife 2. Tag 3 friends who you think deserve to win this contest in the comments below 3. Share this post on story tag @vjsdpl & @srishtidigilife and hashtag #createwithsrishti 4. Every comment is a separate entry so make sure to tag all your friends! 5. Entries tagging fake accounts will be disqualified Winners will be announced on September 30th! . . #srishtidigilife #giveaway #srishtigiveaway #profoto #smalleststudiolight#lightshaping #iamalightshaper #photography #photographyeveryday #indianphotographers - @srishtidigilife on Instagram

Pistoletazo de salida a las fallas del 2019 con la Exaltación de la FMV. #imagen #retransmision #audiovisuales #hd #movil #tecnologia - @arocas_audiovisual on Instagram

Samurais by force. . . Where do you stand #SamuraiOrDemon. Post and nominate someone to do it too. TikTok: Ladipoe.live - @ladipoe on Instagram

CRANE M2. un gimbal para todas tus cámaras, su diseño 3 en 1 ofrece una gran compatibilidad con múltiples dispositivos como, Smartphones, GoPro y cámaras compactas, cambiando sólo una zapata. #zhiyun #craneM2 #estabilizador #gimbal #video #photography #fotografia #filmmaker Para más info: https://www.zhiyunspain.com/estabilizador-camara/estabilizador-zhiyun-crane-m2/ - @zhiyunspain_ on Instagram

On set! Thanks for the hat to @dmglumiere @rosco_labs best wireless @vaxisglobal @hypermedia_intl and power from @bebobbatteries slider @movmaxglobal lenses @xeenglobal #xeencreator camera @arri dolly @jlfisher_inc #dp #dop #camera #cinema #cinematography #cinematographers #lenses #camera #set #work #rosco #dmglumiere #mixsl1 - @edudp_ramirez on Instagram

Yes, #Ledzilla can do that. Im on a mission to educate about the @dedolight Ledzilla at the moment, so heres the next attachment. This is the #DLOBML-LT20 tube for the 8w Ledzilla focusing light. Its a great little device to get that soft glow from a small practical source, an eye light, dashboard glows etc. Considering the light can run on battery for hours on end, it works well for car and remote lighting. Also, ever wonder what you can do with those rosco gel sample booklets you love having? This has a slot built to fit them perfectly! #local728 #local80 #local600 #setlighting #gripgear #setlife #cine #cinematography #cinemotographer #dop #behindthescenes #filmgear #filmlights #filmmaking #filmmaker #filmschool #gaffer #keygrip #griprigs #lightingrental #filmlighting #directorofphotography - @dedolight_california on Instagram

The stage is going up for our Drive-in Concert with Knyght Ryder! A handful of tickets are left, but you need to get them today by 4pm! Visit avcity.org/events - @cityofalisoviejo on Instagram

Shootin.... - @jezzafitz on Instagram

🎥💦 - @x.nxi on Instagram

my heart went ooops - @mrquaydelacruz on Instagram

New Product Alert !! Fugetek Portable 48 Selfie Stick & Tripod. Portable, Lightweight, And Easy To Use. Get awesome photos, anywhere! Grab One Today At Amazon, Link In Bio. #Fugetek #Tripod #Selfie Stick #techie #latesttech #makinglifeeasier #innovation #ilovemygadgets #gadgetsgalore - @fugetekofficial on Instagram

Swipe to see result 🔥 . REELS 📸 : @zono.sann SELECT & CURATED BY : @hardip.tank Travel partner : @creative.visuals__ _-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_- • CONGRATS ON YOUR FEATURE !!!! _-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_- • Always tag #oph • Follow @officialphotograph_hub • Photos must be yours _-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_- #photo_collective #pictureoftheday #capture  #photo #photography#photographer #pic #photographers#streetpotography #streetphotography #streetphotographyinternational  #nature#official_photography_hub#shutterbugs #clicks #_coi#world #everyday #i_hobbygraphy#igersoftheday #mumbai_diaries#dslr_official #streetphotographymumbai#worldwide #clicks #_soimumbai#photography #photographers_of_earth #beautifuldestinations #tcou_ #cool - @creators.gallery_ on Instagram

#arri#skypanels360#ışıkdoktorları #arriservicecenter#cinematography#cinema4d - @arriturkey on Instagram

Sometimes our products are the stars. In this case the FEISOL TT-15 M2 Mini Tripod with the CB-30D Ball Head. A perfect setup for Macro photography and lightweight travel. www.feisol.net A big tank you to @itsworthashot for the photo. His art is out of this world! - @feisoltripods on Instagram

SWIT 60W COB LED Fresnel Light, DMX controlled Focus/CCT/Dim, 15-60°, 25000Lux @ 1m super bright, 2700-8000K, CRI 95 TLCI 97 Review by @shootguru #switlight #COBLED #fresnel #spotlight #backlight #lightsetup #lightdesign #gaffer #dop #filmmaker #studio #studiodesign #dmx #studiolight #videostudio - @swit_global on Instagram

Cavix PH720A Gimbal Head⁣ ✔️ Composed of three independently adjustable arms that ideal for panoramic photography and close-up photography.⁣ ✔️ Quick release plate with standard 1/4 screw and anti-slip rubber pad, easy to install your camera and keep it safe.⁣ ✔️ Ball head supports 360° panning movement with calibrated precision for capturing panoramic overlapping images in horizontal direction.⁣ ✔️ Can be mounted on the tripod, monopod and other devices with 1/4 or 3/8 screw, or Arca-Swiss standard clamp, flexible and stable.⁣ ⁣ #slr #slrrevolution #slr_revolution #cavix #cavix® #cavixgimbalhead #gimbalhead #accessories #accessoriesaddict #tripodaccessories #360degree #closeupphotography #panoramic #panoramicphotography #photography #photographer #sgphotographer #sgphotography #singaporephotographer - @slr_revolution on Instagram

Go behind the scenes with DP @davidcsmithdp as he shoots the all new S1H 🎥 @drivers_eye_la @motocrane_team @lumix @davidcsmithdp #panasonic #motocrane #motocranefamily #russianarm #ultraarm #cameracar #LUMIX #LUMIXSseries #LUMIXS #LUMIXS2470 #LUMIXS1H #LUMIXS1 #LUMIXS1R #FullFrameWithoutCompromise #Panasonic #videography #cinematography #photography #fullframe #mirrorlesscamera #cameralens #toolsofthetrade @lumix - @panasonics1h on Instagram

Trabajando desde casa... (No te pierdas el detrás de cámara) Cámara: #Insta360OneR por @jonsimo - @insta360.pe on Instagram

@denverpari7 setting up @deric_rosenblatt studio for the @vocalpowerpresents filming of @drlindadahl Incredible amount of information! Sign up at: WWW.VOCALPOWERPRESENTS.NYC - @deric_rosenblatt on Instagram

Ready for action - @thescottbancroft on Instagram

The 100W power combo! Supertank Pro and SuperPort S4 is available on Kickstarter! Watch MacMagazines unboxing video:https://youtu.be/4IyKR8FDoLg #Zendure #SuperTankPro #Powerbank #Powerstation #Powerdelivery #Fastcharge #Crowdfundingproject #Tech #Kickstarter #DigitalNomads #Nomads #Fastcharge #techreview - @zendureofficial on Instagram

CLOSED * 💻📱 𝒢𝒾𝓋𝑒𝒜𝓌𝒶𝓎 𝒯𝒾𝓂𝑒 📱💻* 𝒜𝓁𝓁 𝓉𝒽𝑒 𝒷𝑒𝓈𝓉 𝑔𝓊𝓎𝓈 😍😃!! . MACBOOK PRO + IPHONE 11 PRO MAX + AIRPODS PRO GIVEAWAY . 🔻All you have to do to enter the draw is: . 1️⃣ Follow @eastern.giveaways . 2️⃣ Follow all the accounts THEY are following 🤳🏼 . 3️⃣ Add the giveaway post to your story, TAGGING @eastern.giveaways ⚠️ . 4️⃣ Mention your friends in the comments OF THEIR POST💭 . ❗MORE TAGS = MORE CHANCES❗ . ➕ The winner will be chosen based on points + a draw. . 🔺️ The winner will be announced on the 15th of September! . 🤞🏼GOOD LUCK EVERYONE 🤞🏼 . . #giveawayuae #giveawaycontest #dubai #sharjah #sharjahuae #abudhabiinstagram #dubaiinsta #dubaiinstagram #giveawayalert #dxbgiveaway - @makeupbynamrahh on Instagram

iPhone 11 Gobe ND Variable ND2-400 - 72 mm (2Peak) Ulanzi U-rig Metal Beastgrop DOF MK2 . . . . #beastgrip #dofmk2 #beastgripdof #canon #ulanzi #apple #iphone11 - @iphone_filmmaker on Instagram

Thanks to @laron_sound for sharing this mighty MixPre-10 rig! Pro Tip! Carry pink tape and no one will ever walk off with it thinking it’s theirs! #SoundDevices #MixPre #LocationSound - @sounddevices on Instagram

Dolly slider in action! This was a fun one, can’t wait to share. • • • • • #photooftheday #reddigitalcinema #instagood #cinema #commercial #cameragear #6k #cameradepartment #cinematography #behindthescenes #videoproduction #red #super35 #woodencamera #filmproduction #lighting #gaffer #cameraoperator #directorofphotography #camera #setlife #funjob #dowhatyoulove - @booglybeat on Instagram

Cr - @lightwave7 - @punekars.wadhiv on Instagram

Worked with the great @mattmansueto this week capturing the PBR mansion in Glencoe. Flew the drone and created a floor-plan of a 14,000 sqft home. Here is a behind the scan shot of the master bath tub. @matterportmedia #behindthescan #behindthescenes #matterport #milliondollarhomes #bathroom #glencoe #floorplans - @elementsofmedia on Instagram

Monopod for Smile Lite MDP #smilelitemdp #mdp #mobiledentalphotography #louishardan #dentalphotography - @smile_line_from_switzerland on Instagram

parasitic light - @rubenspini on Instagram

Little animated loop for @digitaldoes ‘s Las Vegas Prints. Had a blast last year. ✨ . . . . #usa #primm #lasvegas #nevada #mojave #adobe #aae #digitaldoes #digitaldoesshop #roam - @scottraygeorge on Instagram

Operating a gimbal is never easy without a monitor, trust us, weve tried. An atomos inferno makes a brilliant monitor for your movi or ronin, LUTS, focus assist and a range of codecs, theres so much this thing can do @atomosglobal @movi @filmmakersworld #atomosinferno #movi #monitor #filmmaking #atomos - @optimumpixelsldn on Instagram

For this @nike spot we needed to keep up with olympic sprinter Su Bingtian - this guy runs 100m in under 10 seconds. The @djiglobal Ronin2 and Blackarm by @flowcine just came out and as you can see in the second video I was skeptical in testing due to my previous experience with previous gimbals. We rigged it to an electric car to make sure we weren’t blowing exhaust on the poor guy and the results were awesome. Filmed on @arri Mini with @leica_camera Summilux-C’s Dir. @zeevwaismann #cinematography #dp #commercial #nike @griprigs #leica #alexa #alexamini #bts #airjordans #grip #gripology #ronin #dji #shanghai - @betterdeadthanvideo on Instagram

𝙀𝘼𝙍𝙍𝙄𝙉𝙂𝙎 !!! Made by psp E1000 interior. Full drop coming soon - @semifunct10na1.jpg on Instagram

- Camcorder

...#sonyalpha #gmasterlens #minolta #135mm - @chewy_chew on Instagram

- Micro sprinkler

Rig pic - @samlawsteadicam on Instagram

Simpex SE 400 STROBE LIGHT Simpex Digital studio light SE 400 with built in 2.4 GHz receiver, 400w output for fashion photography, studio photo shoot, outdoor shoot - @simpex.industries on Instagram

Finally got my new set of Coilpacks and plugs!! Thanks @karpartzzz69 🙌🏻🙌🏻🙌🏻 will have these installed and then it’s off to the dyno ☺️ - @abc_builds on Instagram

Saca lo mejor de ti con #OsmoAction #DJI #photographer #travelphotography #sportphotos #action #drone #dronelife #droneshot #beautifulshot #dronepilot #dronegear #travelphotography #natgeotraveller #photoart #dronesdaily #djimc #beautifulview #djiglobal #drone #drones #naturephotography #photooftheday #landscapes #dji #photography - @djistoremx on Instagram

By @jordi.koalitic SWIPE TO SEE RESULT 👈 • To be featured: ➤ Follow us @lovebeforeafter ➤ Use our hashtag #lovebeforeafter ┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈ Connecting and inspiring photographers worldwide. Join our community for daily inspiration! ⠀ ⠀ ⠀⠀ ⠀ ⠀⠀ ⠀ #creativelockdown #landscape_mf #bookstagram #longexposure #book #streets_vision #booklover #reading #bleachmyfilm #themoodymag #streetmobs #creativeoptic #supremeshutter #visualgrams #photoshop #lightroom #artdaily #artshub #art_viral #dailyart #artwork #artgallery #artlover #creative #colordes #art_dailydose #artist #artoftheday #drawing⠀ - @lovebeforeafter on Instagram

Opposites, but attractive. #ViewSonic #ViewSonicColorPro #ColorPro #VP2678-4K #VP2768 - @viewsonic_corp on Instagram

Sightseeing Tours in Madrid #surveillancesystems #surveillance #madrid - @hollmanbg on Instagram

Straw colorblast Camera setup of the photo - @ssadasivs on Instagram

Kamerki Insta360 One R już wkrótce u nas. ・・・ Tired of carrying around 2 cameras for 360 and wide angle content? Insta360 ONE R Twin Edition is for you. Two ways to shoot, just one camera. . Learn more on our website and order today. . . . #Insta360ONER #AdaptToTheAction - @insta360polska on Instagram

- @peovimounts on Instagram

- Pochade Box

📽 - @trinofilmes on Instagram

#MOVEOVER - @starlinesoutheast on Instagram

My @cinemilled control panel giving me the support I need to finesse the shot 😬 filming another tip Tuesday for everyone to enjoy! 🎥 #cinemilled #gimbaloperator #vehiclerigging #keygrip #griprigs #ronin2 #djironin2 #djir2 #roninmethod #gimbalporn #cameraporn #cinemilledcontrolpanel #gimbaloperator #gimbalop #automotivecinematography #suspensionarm #vehiclerig #cameracar #remotehead #setlife #cinemilledgimbaldock #gimbaldock #cameraoperator - @cinemilled on Instagram

Pistol! - @lego_mindstorms_diy on Instagram

Today we announce a very versatile tool that you can carry always with you. The EDC Tool Hex Wrench Model: DW-01 More Info: https://bit.ly/SW_DW-01 RRP: DW-01 US $ 12.95 DW-01T (Set of DW-01 with TN-01, TN-02, CS-01) 13.95 * * #sunwayfoto #sunwayfotodw01 #sunwayfototn01 #sunwayfototn02 #sunwayfotocs01 #accessories #cameratools - @sunwayfoto.official on Instagram

Our friends at Ohio HD @ohiohd #ohiohd have blown us away with these 4 promotional video clips. It was hard to control our lustful drooling the first dozen times we watched these vids and are infinitely grateful for their support. Starting this month, we will post special coupon codes that are exclusive to our Instagram followers. Super deals with big discounts. Please be sure check out all their extensive resources at OhioHDVideo.com Ohio HD has an incredibly talented team and can turn your production dreams into reality. - @therobocup on Instagram

Ну, здравствуйте, осенние дождики😬💦 Видео @katerina__pashina #typicalnvrsk #новороссийск - @typical_nvrsk on Instagram

Trípode para teléfonos 📲 con micrófono 🎤 #Neewer Ideal para las clases en línea #Aprendeencasa #Quedateencasa Llévatelo con envío gratis #ENVIOGRATIS Válido al 1 de septiembre - @neeweroficial on Instagram

1 or 2? What do you think about this? by DYE2UXZJ3P9W(Döuyin) _ Follow @thdrawing for more - @thdrawing on Instagram

Repost from @extreme_uae • Fore Innovation fuel system kit for Mustang S550. Get your fuel system solution from @foreinnovations #ford#GM#chrysler#nissan#pumpgas#ethanolpump#e85🌽 - @foreinnovations on Instagram

@richmediacompany - A successful tandem of reliable brands. We love using our @qscaudio K8s and @sennheiser A2003-UHF paddle antennas for wedding ceremonies 💒 . . #richmedia #qsc #sennheiser #weddingceremony - @qscaudio on Instagram

Shoot the perfect photos with utmost stability using the Fotopro X-Aircross1 Aluminium tripods with up to 8 Kgs of load capacity to make every capture the perfect click. Shop now from the link in the bio📝 and get yours today. . . #bigtrends #onlineorder #buynow #amazon #adventure #bengaluruphotographers #travelblogger #travel #travelphotography #traveling #travelgram #traveler #tripod #bestbuy #cameraequipment #cameraaccessories #camerastand #landscapephotography #capture_today #photographyequipment #aluminium #photographyisart #photographyislife #top_portraits #expofilm #portrait_vision #photooftheday #cntgiveitashot - @bigtrends.india on Instagram

A @opn_bar desenvolveu um acessório para os amantes de cerveja e de ciclismo! O abridor fica acoplado no guidão da bicicleta, e pode ser utilizado a qualquer momento. Essa inovação, que promete facilitar o processo da cervejinha pós treino, não está disponível no Brasil até o momento. Na Europa, ele é vendido em 5 cores diferentes (azul, preto, vermelho, prata e laranja) por um preço de €24,17, aproximadamente R$105,00. E aí, qual amante de cerveja vai querer garantir um desses?! Deixe sua opinião nos comentários: . #bike #bike_naveia #bikefam #biker #biken #bikes #bikesquad #singlespeed #cycling #cyclinglife #roadbike #ciclismo #strava #bici #cyclingphotos #roadcycling #stravacycling #instacycling #cyclingpics #rapha #cyclocross #rideyourbike #lovecycling #cyclinglove #cyclisme #beer #cerveja #cerveza - @vo2bike on Instagram

New For 2020!! The Fugetek 51 Travel Tripod. Great For Phones, Action Cameras, DLSRs. 3 Levels Of Extension, 360 Fluid Head, Light Weight. Introductory Price At Amazon Today. Link in Bio! #Fugetek #tripod #travelphotography #traveltripod #outdoors #portabletripod - @fugetekofficial on Instagram

Pre-Order the newly announce Samyang AF 35mm F1.8 FE with one of our participating stockists in the UK or Ireland, between 14th and 30th September and receive a FREE Samyang Tiny Bag worth £19.99 SRP __________ #Samyang #SamyangUK #samyanglens #samyang35mm #samyang35mmf18 #samyangAF35mmFE #samyangAF #samyanglenses #photography #cameralens #primelens #gearaddict #primelensphotography #newlens - @samyanguk on Instagram

Design Features: Heat moldable bite pads ensure a perfect relaxed fit, enhance your balance and power by 20% and protect you from@concussions. Cam Perfect markings once you find your perfect angle, these let you recreate the shot so you never miss. BTW... still love shooting with my @gopro Session on the new Grill Mount Black. Perfect for the Hero 9 Black. #gopro #grillmount #bestmouthmount - @theprostandard on Instagram

Some excerpts from my 𝟩 x 𝟩 set celebrating @agcook404 and the life-supporting 7G record 💿 Thanks to @unkarakeith for shooting this maximal daydream with me 🎥. Tips n tricks from @instant_sharma. Stream the entire show with beautiful sets from @grrlmusic @baseck @no_rome @thyslaughter @haydendunham & @alexsomersmusic and @carolineplz on YouTube 😘 - @cecilebelieve on Instagram

Hey look it’s us! That’s right, hands free selfie time. . Now get double the action with the TR-050 BoaPod™ by using it with your phone in addition to your camera. This unique tripod also comes with a wireless Bluetooth shutter remote easily paired with your cell phone so you don’t have to reach over and touch your screen. See link in bio. - @carsonoptical on Instagram

To connect with us, call: 9663019921#kinoclouds #adfilms #Filmmaking #advertising #bussinesspromotions #corporatevideo #animation #graphicdesign #creativewriting #ads #portfolio #visualadvertising #filmmaking - @kinoclouds on Instagram

Home. - @jazlynngabrielle on Instagram

captured some foley ambience and cool shots on my hike today :) - @benjirobotmusic on Instagram

We are proud to be a city on the cutting edge of technology. The partnership of @curiositylab_ptc and @goxscooters is the first of its kind. Transportation is changing and The City of Peachtree Corners is excited to be part of the discovery. - - - #curiositylabptc #curiositylab #testtrack #testbed #autonomous #autonomousvehicles #tech #technology #futuretech #laboratory #signs #peachtreecorners #peachtreecornersga - @peachtreecornersga on Instagram

What do you think of this ? 😍🔥 📸 by: DM . Don’t forget to check out our YouTube Channel!! Link in Bio .. —————————— Follow @stunmefpv Follow @stunmefpv —————————— #fpv #kwad #quadcopter #droneracing #fpvfreestyle #freestyle #amazing #travel #traveltheworld #discoverglobe #vacation #discover #epic #insane #cool #musttry #fly #love #life #live # feelgood #feelfree #free #nature #goodvibes #birdseye #view #amazingart - @stunmefpv on Instagram

Bubble - Baloncuk ✨ Credit @mateurbin #sketch #sketchbook #drawing #digitalart #procreate #bubbles #digitaldrawing #digitalartwork #digitalartists #procreatedrawing #procreateart - @jkapplause on Instagram

New-in #siruitripod Zeit zum Wandern, zum Reisen, zum Fotografieren mit SIRUI Traveler Stativ! . . . #sirui #siruiimaging #siruieu #lifestyle #dailylife #cameragear #siruiseries #fotografie #qualitymatters #gearporn #coronaviruswontstopus #wanderlust #landscapephotography #travelphotography #hiking #sommertime - @sirui_eu on Instagram

This is amazing 😳 Which photo effect is more astonishing 😍 1 or 2 ⁉️ Follow @worldsviralhd for more! Via: @raullinaitis - @worldsviralhd on Instagram

- Best dslr

#MavicMini Η απόλυτη ισορροπία φορητότητας, ποιότητας και τιμής! Αποκτήστε σήμερα την έκδοση που σας ταιριάζει: https://www.myhelis.com/dji/DJI-Mavic-pro/mavic-mini #greekrotors #djistoregr #dji #djiglobal #droneoftheday #myhelisgr - @djistoregr on Instagram

One month since I began flying fpv ...that little thing is truly amazing !!! I m just totally addicted to it now, my brain tells me to do it everyday. it reminds me snowboarding or kiteboarding back in the days, same feeling and I wasn’t expecting such that huge addiction to it ... . . . @fpvmagazine @airvuzfpv @gopro @reelsteady @goprofr @official_immersionrc @tattulipos @truerccanada #fpv #fpvmagazine #airvuzfpv #shotoniphone #roquebrunesurargens #fpvfreestyle #fpvlife #fpvaddiction #fpvquad #fpvaddict #goprohero8 #tattulipos - @flimmaker on Instagram

- Camera & Photo Accessories

Nodal Ninja M1-S with RD10 Advanced Rotator - @panosociety on Instagram

Today we announce a very versatile tool that you can carry always with you. The EDC Tool Hex Wrench Model: DW-01 More Info: https://bit.ly/SW_DW-01 RRP: DW-01 US $ 12.95 DW-01T (Set of DW-01 with TN-01, TN-02, CS-01) 13.95 * * #sunwayfoto #sunwayfotodw01 #sunwayfototn01 #sunwayfototn02 #sunwayfotocs01 #accessories #cameratools - @sunwayfoto.official on Instagram

Throwing it back to Feb 2019 when it was so cold in LA I wore 2 coats while being blasted with a torrent of painful hail stones. I played a cameo of ‘makeup artist’ in the music video ‘I Get No Joy’ by @jadebirdmusic directed by the one and only @jamiethraves and shot by the equally one and only Giovanni Ribisi. To get into the role I imagined being a makeup artist in LA, how glamorous life would be and how I’d never need to wear my North Face coat ever again... 🙄 - @emmacroftmakeup on Instagram

Q-RIG 2.0 #a6400 #sonyalpha #smallrig #feelworld #dtap #v #sigma #uurig #newera #creator #videography #film #filmmaker - @livinlifeq2 on Instagram

@emerictimelapse is a master at time-lapsing cities, here he captures a push shot through the railing using Genie One. Swipe for the final shot and ask him anything about how he gets such clean time-lapses in the comments below. - @syrp_ on Instagram

MöVI in the (almost) wild 🌳🌱🍂 #movipro #freeflysystems #gimbal #fs7 #filmset #ronin #feelworld #fujinon #zacuto #sonycamera #musicvideo #directorofphotography - @benjambennett on Instagram

@abineshjp - @ronin__s on Instagram

- Art

#Repost @florianschulzvisuals (@get_repost) ・・・ “America’s Arctic-Paradise in Peril” TONIGHT 20:15 Servus TV - I’m excited to share with our German speaking audience that tonight our film “Americas Arctic - Paradise in Peril” will be shown on Servus TV. Many of you know I’ve been working on this project to document to Arctic Refuge with the Campion Foundation for the last five years. This winter we partnered with Terra Mater to bring out a wonderful film on the Arctic National Wildlife Refuge, a place that has been fought over for the last many decades. When doing the film work to document the refuge it was important to me to convey a sense of place of this incredible land and to show the animals as part of the environment. The Terra Mater team has done a wonderful job to build the sequences and give the images the space they need. It brings the Arctic Refuge to life. We are currently working with Terra Mater on the IMAX and Giant Screen Film. There will soon be a release across the US for the television and film as well and I will announce it here. For the German speaking audience in Europe, I hope you can find a way to tune in for the show tonight. - @wunderweltenfotofestival on Instagram

SWIPE LEFT 😃 One camera mount, endless possibilities... for @filmakrs #actionsports #snorricam #willsmith #surfing #motorsportsphotography #mountainbiking and much more #3rdpersonview #cameramount by www.sailvideosystem.com Special thx to @chrisrogers @austinkeen @willsmith @fallontonight @bienvenidoaguado and all our users and fans - @sailvideosystem on Instagram

Rate 1-10 Credit: @colorbyfeliks Follow us @art_chitrakala . Do you want immediate feature? Contact us! 📥 . ⚠No ©Copyright Infringement Intended❌Email (contact) us to fix/remove #art_chitrakala #instaartist - @art_chitrakala on Instagram

- Special Deals!

By discovering nature, you discover yourself. ... “If you truly love nature, you will find beauty everywhere.” Nature always wears the colors of the spirit. Look deep into nature, and then you will understand everything better. Just living is not enough. #nature #naturephotography #naturelovers #sunlight #sunray #sunrise #sunshine #tower #signaltower #signaltowerhill #beutiful #natureofinstagram #natureofpakistan #beautifulray #art #portrait #followforfollowback #followme #portraitphotography #picby @nouman_anjum_ #thanksby @portraitsbytafakhar #fan @andrejcie @lightroom @lensbible @dineshjangra71 - @portraitsbynouman on Instagram

Handheld stabilizers are the all the rage — and for good reason. These handy video production tools allow camera operators to capture smooth shots without sacrificing freedom of movement. ⠀ ⠀ Weve updated our Best Camera Stabilizers for Video-2020 Guide! (Link in bio). ⠀ ⠀ We go over the specs you need to check when you purchase stabilizers and cover the categories:⠀ ⠀ -Best One-Handed Camera Stabilizer⠀ -Best Non-Motorized Camera Stabilizer⠀ -Best Budget Camera Stabilizer⠀ ⠀ Are we missing a standout stabilizer? Let us know in the comments!⠀ ⠀ #camera #camerastabilizer #cameraequipment #photography #videography #DJIOSMO #Glidecam #DJIRonin #DJI #videoequipment #videoproduction #BuyersGuide #BestOf #Bestof2020 - @videomaker on Instagram

If i released this 2color, which one do you wanna?#taschenlampe #ledtaschenlampe #sofirn #edcDE#edcuk #edcitaly #torcia#sofirnflashlight #sofirntaschenlampe - @sofirnlight_adelina0819 on Instagram

#portrait #sinar#standerd #4x5#doragon#waterfall #nara - @seeing_itself on Instagram

What is your favorite drone in these days? 👀 - Like this content? Follow us 😃👉🏻 @dronephotography10 - 🔥Mark 1 friend that love drone - 📷 Photo by: @alongarini - @dronephotography10 on Instagram

Picture Credits: @u.m.e.r.m.i.r.z.a #naturalbeauty #nationwide #naturephotography #photographylovers💕💕 #nailsofinstagram #new #camera #greenery #lakes #lake #water #tripod #forest #mountains #grass #coldweather #crushes #confessions #rawalakot #rawalakotdiaries #ajk #picoftheday #winterwonderland - @rawalakotsafari on Instagram

- Camera & Photo Accessories

At home production studio! Our creatives are at home and ready to create. If you have marketing needs, we can do everything virtually -from planning to final delivery. DM me for more info! #stlcreatives #stlartist #stlphotographer #foodstylists #stayathome #stlmarketing #lacreatives - @repheads on Instagram

Livet som pappaledig. Lär inte dottern bara att baka utan också att fota det som bakas. #baka #surdeg #livetärunderbart #pappaledig #baraförattzipkan - @zipnet on Instagram

Very convenient combination. @pdmovie_official @inkeetech #pdmovie #pdmovieliveair2 #liveair2 #wirelessfollowfocus #followfocus #focuspullers #focuspulleratwork #focuspuller #benbox #videography #videographer #filmmaker #filmmakers #cinegear - @pdmovie_official on Instagram

@the.shepherds.outdoors giving the Binos a boost... ・・・ A little upgrade to my @atncorp #binos I attended the @sniperhoglights #66lrx #predatorhunting #predatorhuntingsuppressed #nighthuting #coyote #coyotehunting #nightstalkers #nightwalkers #nightvision #atn #atncorp #lightupthenight #ownthenight #sniperhoglights - @sniperhoglights on Instagram

Thank you @wessiler and @outsidemagazine for this write up on our monopod! You can see the article at Indefinitely Wild or click the link in our profile. #kestrelnation #glasssmarter #smarterpredator #meateater #pnwild #elkhunting #muledeerhunting #outsidemagazine - @kestrelglassingsystems on Instagram

Amazing collaboration with some amazingly talented people. One day of shooting in #Brooklyn and one day upstate at #hawksnesthighway for a bank heist scene. Every time I go out with the #stabiloid I learn different aspects of how it works and the BTS/witness cam are a big part of that. Being able to review the footage and see the actual dynamics of what’s happening is such an asset. Director: @jackwithcola DP: @gagezanghi AC: @jordantaylorfuller Precision Driver: @jnicksweeney Camera: @steadishot Stunt Riders: @therichiegshow @alessandra_milena Support: @dominicgiello . .. . . #scalcateam #bmw #camera #cameracrew #cameracar #grip #stabilizer #gimbaloperator #gimbal #chasescene #osmopocket #teradek #fcpeuro #lifeonset #lifeonlocation #bmwmotorsport - @steadishot on Instagram

Aquí el staff que tiene Don Álvaro - @lalovillarp on Instagram

Me “working” last night. But really it was a blast to shoot for @hometomorrow406 #onewheel #canoneosr #zhiyun #weebills #filmmaking #missoula #thousandhelmet - @silvadesignco on Instagram

Canon eos 9000d/77d Sett lensa 18-55mm dan 50mm Bonus tripod dan tas Harga 81000 yen Assalmualaikum wr wb Bismilahirrohmanirohim Dijual santuy Kondisi second normal jaya Kelengkapan sesuai foto Free ongkir free memori via tf yucho Jangan lupa jika ulpoad hasil foto/video bisa tag kami ya @ibaraki_kamera Follow juga fans page dan instagram kita ibaraki kamera Chek testimoni di instagram Ya kak Ada give away nya juga lo Yg minat bisa dm guys sankyu Setiap pembelian 1 unit kamera 1000 yen kita akan sumbangkan ke yg membutuhkan Tanya tanya kamera dan lensa lain juga ada guys ☺️☺️🙏🙏 #kenshuusei #kensyu_hits #japanhits #kensyusei #kenshuseiindonesia #kenshusei #kenshusei_imjapan #kenshuuseijiaec #tokuteiginou #tokuteiginouindonesia #immjapan #japanreviews #magangjepang #kenshuseijapan #kenshusei_imjapan #kerjakejepang #kensyusei #kenshuuseipremium #jishuseiindonesia #japan_reviews #japan_hits #kensyuhits #japanhits Sankyu - @ibaraki_kamera on Instagram

Finding a perfect set up for recording? 🙋‍♀️Try STM01 🙆‍♂️Sounds Awesome! #livestream #studio #studiophotography #studiolife #studiolife #studiomic #podcast #podcastlife #podcaster #comicamicrophone #audio #audiosetup #audioequipment #studiosetup #studioequipment #vocalist #recordingstudio #recording #audioman #cover #coversongs #coverband - @comica_microphone on Instagram

So.. been working on a project.. @nullmodular getting closer!! BIG ups to @hellohowardyou for holding it down 🙏❤️ #modularsynthcase #modularsynth #lit #hackadayprize #audioreactive #eurorack #eurorackmodular #eurorackcase - @meghan_hui on Instagram

Riprese video da... professionista? Solo con Hohem Gimbal 😉 Backstage di Pop News TV con il nostro Compact Gimbal! #hohem #smartphotography #videomaking #photography #video #smartvideomaking #gimbal #stabilizer #stabilizzatore #smartphone #selfie #selfiestick #hohemgimbal #instatech #facetracking #ios #android #technology #compactgimbal - @hohemgimbal on Instagram

👉 SAVE THIS POST 👈 Due to popular demand, here is a collection of some of my best Instagram quick-effect tutorials! Be sure to save this post as a reference for the future! All of these videos took lots of time to make so I really appreciate everyone who has supported the content! Don’t worry, more tutorials are coming next week ❤️ ⁣ .⁣ .⁣ .⁣ .⁣ .⁣ #effects #video #videoediting #cameragear #cinema #cinematography #videography #filmcommunity #specialeffects #videographer #tutorial #diy #films #filming #cinematographer #losangeles #behindthescenes #video #movies #howto #videoproduction #diy #dop #filmphotography #cinematic #film #art #filmmaker #director #filmforever - @momentum_productions on Instagram

🇺🇸🇬🇧 Do you know what AOTAKE is? ✈️ During WWII, the Japanese aeronautic industry applied a protective anti-corrosion product called Aotake to the metallic structures of their aircraft. The final aspect consisted of a range of metallic shades from green to blue. If you want to achieve this particular look, check out this step by step or visit link in bio. . 🇪🇸 ¿Sabes lo que es el AOTAKE? ✈️ La industria aeronáutica japonesa durante la II GM aplicaba en las estructuras metálicas de sus aviones una capa protectora anticorrosión, un producto translúcido denominado “Aotake”. El aspecto final abarcaba un abanico de tonos metalizados entre verdosos y azules. Si quieres conseguir este aspecto particular, revisa este paso a paso o visita stories y el enlace en nuestra bio. . . #alwaysvallejo #IIWW #vallejocolors #modelcolor #modelismo #aotake #history - @vallejocolors on Instagram

Get a vacuum that doesn’t take too much space. Air Force 360 Light is effortlessly compact for easier storage. Learn more at www.tefalairforce360.com/light #TefalTechnology #TefalAirForce360Light - @tefalsingapore on Instagram

- Art

Cuando te ve de frente es cuando sabes que lo necesitas - @canella_canon on Instagram

#bts create cool movements with #laowa lens 24mm 🎥 #blackmagic 6K - @awesomeemirati on Instagram

I always felt teaching in school was like putting on a performance...might as well go all in now...😅. Forever grateful that my students push me to learn new things and to always challenge myself because they deserve the best...these little intros to my lessons were new for me to learn but actually very simple...just stacked my phone on some boxes and recorded a time lapse video, then added music to it in iMovie. If this grandma can do it so can you.... - @karaluna_designs on Instagram

Get your shoots perfect with the E-image ES-120 Camera Slider from E-image Model- ES-120 --------‐----------------------------------------------------------- ⁣⁣ ⁣⁣Use #ReliablePhoto to get featured ⁣⁣ ⁣⁣--------‐----------------------------------------------------------- ⁣⁣ ⁣⁣Improve your skill set #LearnWithReliable ⁣⁣ ⁣⁣--------‐----------------------------------------------------------- ⁣⁣ ⁣⁣ #videogear #camera #cinegear #cameragear #mygear #placeforcreators #create #tripods #easytocarry #travel #photography #photographyisart #photographyislove #photographyislife #lovephotography #travelphotography #travelblogger #handheld #stabilizer #sliders #photographers_hub_india #photographers_of_india #carrylight #traveler #perfectshot #eimage #eimageindia #eimagees120 - @reliable_photo on Instagram

Introducing the new Godox AD300 Outdoor Flash. Coming Soon! #godox #godoxindiaofficial #godoxindia #godoxad300pro #godoxlighting #outdoorphotographer #nagpurphotographers #nagpurvideographers #nagpurfashionphotography #nagpur #vidarbhaphotographers #altafhvali - @altafhvali on Instagram

Even though we were up at the buttcrack of dawn and were getting eaten by a thousand mosquitos.. it was totally worth it! @kristenmhollis @zachary_hollis95 #weddingstories #westpalm #beachvideo #lovethiscouple www.centerup.video #blackmagicpocketcinemacamera6k - @centerup_video on Instagram

Now accepting orders for the MV3 90 Mounts and will begin shipping Monday the 24th. - @long_range_arms on Instagram

Exclusive offers, discounts up to 45% Download the application now 🔥🔥🔥 - @manfrotto.imagine.more on Instagram

📷 by @focusingfilm - #TLR #120 - @doddcamera on Instagram

i’m back ✨ - @_aplmrl on Instagram

- Workout for flat stomach

New Arrival 🎥 Nitze Monitor Holder Mount ELF Series Low Profile N54-G1--QR cold shoe to 1/4”-20 screw with locating pins N54-G2--NATO clamp to 1/4”-20 screw with locating pins N54-G3--1/4”-20 screws to 1/4”-20 screw with locating pins N54-G4--3/8” ARRI locating pins to 1/4”-20 screw with locating pins #nitze #nitzerig #nitzecameracage #monitorholder #monitormount #videomaking #videographer #filmmakerslife - @nitzevideography on Instagram

Follow along with the adventures of our new 8K VR camera. This a customized 360 camera that photographs in high definition 8K. It is ideal for capturing large commercial grade spaces. #architecturephotography #360view #8kcameratechnology #boston360 #comercialphotography #capturingspace #bostonvirtualimaging #8kvrtour #capturingthespace #commercialrealestate #comercialmarketing #marketingtools #cooltechnology #photographytools #vrcamera #360camera #professionalphotographer #vrtechnology #commercialconstruction #newdevelopmentmarketing - @bostonbvi on Instagram

🔺 New massage gun used for your muscle wake up call then warmed up and moved into Lat/back day: straight arm pull downs, snatch grip deadlifts, lat rows, cable pull downs, and finished with pull-ups and holds. Felt good and the massage kept lactic acid down between sets. Finished with an increase RPM to move the lactic acid away and followed by stretching and a protein shake. Do you do active care? ⠀ #Gymnastics#gymmotivation#gymnasticslife#gymnasticstraining#percussivetherapy#nuoruxgun#fitnesslifestyle#fitness#boxing#dancing - @nuoruxofficial on Instagram

- PiDSLR - Standalone Enclosure for the 12.3MP Raspberry Pi Camera Module

Hot Dog Slider, easy-operated gear that gets you really awesome footage. . Thanks for the amazing photos! Credit to: @director_enman @behindthescenegram . . #yconion #yconionslider #camerasetup #tvc #filmcrew #filmworks #filmmaker #filmproducer #cinematography #timelapse #productioncompany #directorofphotography#yconiongear #filmmaks #Filmmakinglife #Camerarig #slider #Sliderreview #travelvlogging #cameraslider - @yc.onion on Instagram

300ws of power without the cables! The new AD300Pro is here! You can order yours through your local #authorizeddealer today! #godox #godoxad300pro #godoxad300 #godoxadseries #flash #strobes #godoxcanada #shoplocal #upyourgame - @godox_canada on Instagram

#edelkrone around the world 🌎 by: @jonzzzsh⁠ Tap the image to shop SliderPLUS PRO Long & HeadONE & Slide Module & Soft Case for SliderPLUS PRO Long 👆⁠ —⁠ #edelkrone #SliderPLUS #HeadONE #SlideModule #SoftCase - @edelkrone on Instagram

2 IN 1 Mini Tripod+L Bracket Stand With 2 Hot Shoe for Zhiyun & DJI Smartphone Gimbals to Attach Microphones and Lights - @b.n.w.collections on Instagram

- Diy photography

Fotografové nejen architektury na cestách POZOR!! Nová třícestná hlava s plně fluidním systémem je na světě a to v zatím nejkompaktnější velikosti od Manfrotto! Výkon na cesty bez kompromisu 🌎📷 . . #manfrottoimaginemore #manfrottotripod #manfrotto3wayhead #inovace #nacestytonejlepší #nacesty #canonczsk #sonyczsk #nikonczsk #panasonicczsk - @manfrottoczsk on Instagram

Product photography BTS 📸📹🎥⚪️💡 #productphotography#ecommerce#ecommercephotography#studiohire#studiohirebirmingham#infinitycove#infinitycovebirmingham#hoverboard#phosmedia#studiophotography#fashionphotography#bts#naturallight#pixapro#ledlights - @phosmediastudiohire on Instagram

Garni Temple in Armenia captured by @jrffe and @devin.ghar along with @tumocenter. They aim to preserve 7 great architectural artifacts around the world digitally by using 3D laser scanning. . . . . . #heritage #preservation #laserscanning #FARO #Focus #architecture #farofocus #faro - @farotechnologies on Instagram

FilmGear HMI F4k & C400 bi-color LED 400w panel in the works. For a limited budget feature, these 2 made a good team for everything youll need. Thanks for sharing, Nick Janssen. #local600 #setlighting #local728 #cinematographer #setlife #filmmaker #gaffer #filmgearusa #HMI #LED - @filmgearusa on Instagram

Playing around with new @djiglobal #matrice300rtk #h20t camera. Most of our activities center around #filmmaking, but we try to help #volunteering organizations in Estonia flying during search and rescue operations and thats where this type of drone is irreplaceable . New Matrice feels in the air as very solid piece of #engineering - long flight time, redundant GPS supporting all known services, multiple obstacle avoidance sensors and much more. Right now attached hybrid camera, which basically is 3 cameras in one - 20x optical zoom, wide angle and high resolution #thermal cameras! + laser rangefinder. Thats really cool and compact. . @droon.ee @djiarsvilnius - @skycam_ee on Instagram

@buldozlife - @sleepy.grill on Instagram

An amazing and perfect click, keep clicking and motivating all the photographers. Picture credits 🎖️ @jordi.koalitic 🎖️ 〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️ Keep tagging us in your amazing clicks📸 and use our hashtag #hotshot_clickers 〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️ 🌎 Our goal is to unite all the photographers and give exposure and inspiration to all the aspiring photographers. 🌏 〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️ 📷Shout-out for all photographers 📷 〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️ #beforeafter #creativephotography #jordikoalitic #propphotography #photooftheday #featurepage 〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️〰️ Need even more inspiration? Check out these other amazing feature pages: @alltheoceanblues  @delightfulportraits @lookforlights @bnw_lumeilio @artofbokeh  @crypticsoulss @portraitgasm @visualsvibed @so.kurai @artistic.avenues @featureshout @shootsandflowers @small.features - @hotshot_clickers on Instagram

nodalninja I am glad to announce Peter Ensrud won the first place. @ensrud_photography #WinNodalNinja #NodalNinja #Mecha #photoshoot #behindthescenes #PhotoContest #360 #360photo #panorama #takeapicture #photography - @nodalninja on Instagram

Crane 2S can hold 2 cameras!!! Do you think this go well with you? #crane2s #sonya7iii #sonya6400 - @zhiyun_poland on Instagram

Soooo I got a new ring light! 💡 I love my larger one but this should help bring a little more mobile... what kinds of social media or freelance types of videos would you all like to see?! 👇🏽👇🏽👇🏽 #freelance #freelancer #create #creator #contentcreator #fun #video #series - @bizbeactive on Instagram

Nuovissima gopro hero fusion Non un bel design ma ha la migliore risoluzione di sempre - @goproitalia_official on Instagram

Post a photo or like a contest photo to win! Every panorama shoot requires planning and setting up of equipment. We look for static images of a Nodal Ninja product all set up in the scene ready to shoot a panorama. Like a contest photo on Facebook or Instagram for a chance to win even if you don’t own a Nodal Ninja. https://nodalninja.com/win #WinNodalNinja #NodalNinja #Mecha #photoshoot #behindthescenes #PhotoContest #360 #360photo #panorama #takeapicture #photography - @nodalninja on Instagram

Thanks for the shoutout @chipembere_rhino_foundation and for the incredible work you are doing conserving rhinos 🙏🏻 🦏 🌍#repost @chipembere_rhino_foundation ・・・ Another big thanks to Cause Conservation and all the donors who put their hands up in support of rhino conservation. The funds raised at their September 2019 event in Laguna Beach has now funded a further 7 VHF rhino leg collars and recently 8 of these Spartan camera-traps. All of these items are vital tools in helping to combat rhino poaching and assisting in the safe guarding of rhino. @causeconservation @linnieschmidt @debzandbella #chipembere #rhino #foundation #conservation #chipembererhinofoundation #savingrhinooneatatime #saveourrhino #stoprhinopoaching #africa #makeadifference #blackrhino #saveourrhinos - @causeconservation on Instagram

Gimbal Feiyutech AK series. 🔁 Filmmaker: @shan.ranasinghe , . . ⭐️ Welcome to the FeiyuTech Family ⭐️. 📌 Follow @feiyutechfamily and Tag us to get featured. . . 💬 #feiyutech #feiyutechgimbal #feiyutechgimbals #cameragimbal #gimbal #gimbaloperator #filmmaker #videographer #feiyutechfamily #cameragear #filmgear #dop - @feiyutechfamily on Instagram

Alternating these 2 sets of ortf mics between takes gives a nice depth and seems to help stuff sound less phasey when Im stacking lots of overdubs.... What other techniques do you guys use to make the most of the limited space of home studios? 🎶🎉♥️ ... ... ... ... ... #sennheiser #mkh800 #schoeps #ortf #musician #recordingstudio #remoterecording #musiciansofinstagram #musicians - @pjcartwright on Instagram

Exclusive limited first run of Multicam Black #ravenwrap kits for those L/R shooters running carbon fiber tripods and wanna blend. Only 10 available to ship, DM us to place an order. Fits: @hogsaddle_official pig0311 @rrssoar 24L, 33, and 34L Manfrotto 055 carbon/aluminum $319 shipped - @truenorthraven on Instagram

Hip hop hooray for the array (for today, anyway) - @pjcartwright on Instagram

Rate 1-100! An opinion on this drawing Adt by @colorbyfeliks Follow @carla.scemama for more art! - - - - - - #pencilsketches #sketchingart #sketchingdaily #sketchinstadaily #sketchink #drawing_pencile #artist_features #portraitsketch #portraitdrawings #artist_4_shoutout #artworksinsta #artworks_portrait #art_draw #dailysketches #sketchesoninstagram #drawingtutorial #art - @art_regrams on Instagram

- @barak_brinker on Instagram

Bastidores com o repórter @ednardoalvesoficial gravando sobre a volta gradual do Geopark Araripe. 📺 #jornalismo #tvverdesmarescariri - @tvverdesmares on Instagram

- Camera & Photo Accessories

been in the lab for many sleepless nights lately, working on a whole new setup, and learning a ton. live shows are not going back to the way they were anytime soon, so we got to adapt. everyone is in the same boat. the new possibilities created by the limitations are exciting. sooo lets go • also: that vid is of a color cam CCD sensor prism. its the most alien piece of tech ive ever come across. the stuff humans make is wild • shoutout to @restless_atoms and @_morasso for verifying my hair-brained schematics or lack thereof - @half_state on Instagram

Soporte para celular sobre cámara. El soporte es expandible y se integra a la cámara mediante la zapata para flash. Valor: $4.000 #chile360 #chileenunaimagen #turismochile #foteroscl #canonistas #nikonchile #sonycamara #recorriendochile #rebel #travelphotography #trekkingchile #rayadosporlasfotos #fotosmartchile #instatemuco #instaconce #angolcity #instavillarrica #bokeh #portrait #chillan #osorno #surdechile #southofchile #naturephotography #naturalezachilena #chilefotos #chile_bloggers #fotografiaamateurchile #wildlifechile #outdoors - @fotosmartchile on Instagram

Oh this virtual life...”On” shoot yesterday with Lia Cirio, Paul Craig and Ernesto Gallan! At Bancroft Castle. Slomodrift dream team! - @helenpickettchoreographer on Instagram

Mavic Mini Combo Sealed Box Ready Stock Available. #dji #djiban galore #djimavicmini #dronephotography #droneindia #djiindia #djiindiaofficial #djingismylife - @djibangalore on Instagram

Yuk Buruan Ikut Pre-Order Sekarang ! Dapatin Bonus segabrek. Dapatkan FREE Backpack Kamera @VANGUARD_ID Aspire 41 Senilai Rp. 600.000,- + Extra Potongan Rp.150.000 untuk pembelian VEO 3+ 263AB via #Blibli. VEO 3+ 263AB all-in-one Premium Tripod. Hadir dengan teknologi Multi-Angle Central Column (MACC) yang mudah dioperasikan dapat di pindahkan 360° ke segala arah dan memungkinkan kamu dapat berpindah dari mode horizontal ke mode vertikal dalam hitungan detik, di lengkapi ball head VEO BH-160 yang mampu menjaukau semua sudut ideal yang kamu butuhkan dengan mudah serta kaki tripod yang dapat di lepas menjadi sebuah MONOPOD. Buruan pre-order ini hanya berlaku sampai dengan 10 sept 2020. More Info Visit : @VANGUARD_ID #tripod #tripodvanguard #taskameravanguard #tripodkamera #tripodkameradslr #tripodkameramirorles #monopod #tokokamera #tokokameraonline #monopod #monopodkamera - @vanguard_id on Instagram

Our TC7s superior carbon materials weighs just 1.86kg and costs as little as $299 📸 @meliepiergear . . ⁣#ifootage #ifootagegear #monopod #tripod #cameragear #videography #photography #photographer #camera #videography #cinematographer #cameraslider #filmmaking #fluidhead #cameragear #camerasupport #CinemaCamera #GearPorn #Cinematic #Cine #CameraRig #CameraSetup #FilmMkrs #fujifilm #canonr #sony #nikon #sonya7ii #mirrolessgeeks #xpro2 - @ifootagegear on Instagram

Enjoying these last few days of shooting in Mexico—leaving Valle de Bravo and on to Ixtapa! - @barleezy.squeeze on Instagram

Click on the profile for the fuller effect 😉 - @marvin2004han on Instagram

Thr RCA Adapter is now available for Scorpion. A great accessory if you want a more upright angle of the cable and more hand clearence. Available at inkmachines.com #inkmachines #scorpiontattoomachine #rcaadapter #tattoomachine #tattoo - @inkmachines on Instagram

Fotopro in Hungary, exciting! @studiolinefototechnika #fotopro #fotoprotripod #tripod #tripods #camera #hungary - @fotopro.official on Instagram

New member!!! Saramonic v mic mini. Loving it. Review soon. Stay tuned. Quality content. . . . . . . @saramonic_international - @eashuzzz_official on Instagram

- colors

Check out some past rentals at Apex Studio! @adrenalineworldwide and gang killing it with @hollanddiaz On that amazing @dollamur flexi-connect tatami flooring! We’re Lovin’ the style! This 5,000 sq ft warehouse & office space is available for various types of rentals, projects, private training and more! Please inquire about current rates as well as new covid safety protocol! Stay safe out there, everyone!! 😎💥🙏🏻 . . . . #adrenalineworldwide #dollamur #dollamurmats #dollamurmartialarts #filmstudio #atlfilmstudio - @apexentertainmentstudios on Instagram

18x telescope phone photography kit #apexel #apexellens #telescope #monocular #tripod #photography #photographers #iphoneography #lens #zoom #octopus #mobile_phoneography #mobilephotography #outdoor - @apexelofficial on Instagram

Angles. . . . #weberworkshops #EG1  #precision #barista #coffee #grinder #tools #specialtycoffee #workflow #miseenplace #singledosing #spaceage #outofthisworldgrinding #コーヒー #ミル #オニキス #ウェバーワークショップ #極上コーヒー器具 #次世代 - @weberworkshops on Instagram

🇬🇧 The Caman system is the ideal companion for your trips in the field! 🇫🇷 Le système Caman est le compagnon idéal pour vos déplacements sur le terrain ! . . . #filmmaker #videomaker #cameragearaddict #camerahandle #documentaryfilmmaking #documentaryfilmmaker #filmmakerslife #camanhandle #sonyfs7 - @caman.swiss on Instagram

- IDÉES

DISPERSION Installation Galerie V2, Charleroi 12/2019 - 01/2020 DISPERSION Installation Galerie V2, Charleroi 12/2019 - 01/2020 Utiliser le sensible comme vecteur de compréhension de la complexité. Laetitia Bica est une artiste contemporaine qui place la recherche au coeur de son travail. Si son propos est avant tout de « faire image », soit de donner à voir, de révéler, il est essentiel de considérer ses œuvres comme des boutures, dont chacune est la trace d’un processus créatif qui, d’hypothèses en expérimentations, questionne le rapport de l’artiste à son environnement naturel et humain. Avec DISPERSION, Laetitia Bica mène sa recherche sur les bassins miniers du Nord de la France et de la Belgique en explorant trois pistes principales : celle de l’accumulation documentaire de traces iconographiques in situ, celle- avec Corentin Spriet, chercheur à l’UGSF 1, de l’interprétation de données théoriques et expérimentales par le travail sur l’imagerie scientifique au cœur des laboratoires de TISBio 2, et celle de la création plastique, proposée comme prolongement des résultats obtenus. 1 UGSF : Unité de Glycobiologie Structurale et Fonctionnelle de l’Université de Lille 2 TISBio : Traitement du signal et de l’image pour la biologie – Université de Lille. https://tisbio.wixsite.com/tisbio - @laetitiabica on Instagram

DigitalFoto Spider RoninS & Crane2 mounting ring with a strap. https://www.digitalfoto.cn/digitalfoto-spider-ronin-s-amp-crane-2-mounting-ring-adapter-clamp-for-mounting-lighting-monitor-led-with-strap-p00170p1.html @julien.creactiv reviewed it, Big thanks to him. #ronins #crane2 - @df_digitalfoto on Instagram

- @coloradotripodco on Instagram

The Cloud Mount Pro now in the arsenal of @iamtamlam and available for rental in LA. - @rigwheels on Instagram

Got a #timelapse of the #fullmoon today in #Pittsburgh with the #GoPro - @viewpgh on Instagram