Someoneelse Profile Pics

someone elsenetflixsouth parks9e7erection daysomeonetheres someone elsesaturday night livesnllove
these arent someone elses children theyre our children children joe biden biden

👉 HOy fue un dia MÁGICO 🌠 ⛼ Desde Anoche sabiamos que teniamos que ir a retirar el Panel Solar que nos regalaron nuestros Amigos de @lacasitadelosmonk 💜🤗 💪 Nos levantamos y salimos muy emocionados 🤩 Intencionando el agradecimiento y El amor hacia los MONK 💜 👉👉👉 LLegamos a casa y la emocion al abrirlo era la de un niño recibiendo su regalo en Navidad 🌲🎁 😁 Lo contemplamos y nos alegramos en familia (y con varios de ustedes que nos mandaron muchos msj de felicidad compartida)👍😉 👩‍🔧👨‍🔧 Seguimos trabajando en los muebles y el abuelo en la ventana que faltaba🧓🏻 👏 Asi Pasamos la tarde y nos llega un 👉📧 MENSAJE, SIIII...OTRO MENSAJE 💜 LLENO DE AMOR Y DE SENTIMIENTOS VERDADEROS 🤗 😱 PARA NUESTRA SORPRESA OTRO ANGELITO 😇 DESDE ROSARIO NOS COMUNICA QUE QUERIAN SER PARTE DE TODO ESTO con su EQUIPO DE TRABAJO, que querian AYUDARNOS A CUMPLIR NUESTRO SUEÑO 💪🚙 🧡 SIMPLEMENTE DARNOS UNA MANO Y SER PARTE (UNA REEEEEE MANOOOOO PARA NOSOTROS)😁👨‍👩‍👧 ➡️➡️ SABEN COMO NOS QUIEREN AYUDAR?? 🤔 🤗 BRINDANDONOS EL SEGURO DE LA HAWAIIANA 🚙 PARA TODO EL MERCOSUR!!! 🌍😱🤩 💪💪 sisii asi como lo LEEN😍 NUEVAMENTE SORPRENDIDOS Y AGRADECIDOS DE 🧡 👨‍👩‍👧👍 ESTO NOS AYUDA MUCHO A SEGUIR AVANZANDO 🚙 Y LO QUE MAS NOS LLENA EL CORAZON ES SABER QUE LOS INSPIRAMOS A CUMPLIR SUS SUEÑOS, METAS 🤩🧡 ➡️ YA SEA VIAJAR POR EL MUNDO, CAMBIAR DE TRABAJO, EMPRENDER UN PROYECTO PROPIO, ESTUDIAR UNA CARRERA, CAMBIAR TUS HABITOS ETC👏 SEPAN QUE LOS SUEÑOS SE CUMPLEN SOLO HAY QUE VISUALIZARLOS Y TRABAJAR POR ELLOS 🤩💪🧡 ➡️➡️ En unos dias subiremos todo lo referido al Seguro 💪🙂 🤗 NO PODEMOS MAS DE ALEGRIA...Nos vamos a dormir con una Sonrisa 😍 Buenas Noches para Tod@s 🌠👍 . . . . . #puravidapinamar #VIAJANDOXLASOLAS #depinamaralmundo #nicoruth #bendecidos #seguromercosur #gracias #felicidad #familysurf #familiaviajera #VANLIFE #LIFESTYLE #CAMPERLIFE #sueños #travelingfamily #planetaworldschooling #overlandingsouthamerica - @viajandoxlasolas on Instagram

frozen olaf love putting someone else

A constant blessing in my life 💕 (That’s my hat this time) - @juliana.chali on Instagram

shoulder shrug austin evans what else do you want what else do you need what are you waiting for

James & his lovely wife Francesca ❤. Gnarly ride bro 😆. . 📸 from Pinterest #metallica #jameshetfield #music #guitar #concert #instagram #throwback #kirkhammett #larsulrich #roberttrujillo #rock #metal #studio #goodnight - @metallica_daily on Instagram

how could i ever love someone else olivia rodrigo drivers license song saturday night live i cant love anyone else

Hi I’m getting married in 10 days. I’m not sure how I feel but I’m trying to tap into it. I feel excited, excited to see Chaim. Excited to have Chaim forever in my life. I’m excited to be a bride and on my wedding day deeply connect to Hashem, the Rebbe, Chaim, and a few other private and important people in my life. I’m excited to connect to me. They say your wedding day is compared to Yom Kippur— the holiest day of the year. I haven’t kept Yom Kippur in 10 years and each time it hurt so deeply. The last Yom Kippur I remember was when I was 17 Yrs old In 2010. I remember that year I completely lost touch with myself & what it meant to live a healthy balanced meaningful life. My world immediately went downhill. I became anorexic, went to rehab 3 times stayed at a residential treatment center, got engaged broke it off, overdosed on alcohol and started blacking out. My wedding will be my first sober Yom Kippur. It’s going to be a time for me to genuinely and wholeheartedly connect and speak directly to Gd. A real connection, because it’s a sober connection. Now I know how I feel........ blessed 💗 - @bre_designs on Instagram

everyone else yongyea all of us everybody all of you

#NYFWM Day 2: The MH Style Team coordinating patterns like pros. #notonpurpose Thanks for the lift, @cadillac! Missing you, @brianboye #andthenthereweretwo - @menshealthstyle on Instagram

somebody else is real housewives of potomac someone is might be somebody gizelle bryant

So proud to be part of such an amazing event! ❤️ @shuckcancernola @americancancersociety @heaton_it_up - @libbygphilips on Instagram

1install crestron control4 smarthomes home automation

Grateful - @r3b3jan3 on Instagram

something else blazybard robbie trickett smite anything else

Playful shelter, headscratch landmark, games of NY - and a nice document from @timeoutnewyork / thanks to @banzarbar for the commission! - @montanasimone on Instagram

tell me more do tell cool story

Wrote this chapter of my book, GIRL, over a year ago and am now very excited to see it published as an extract in today’s @obsmagazine! Thank you @harrietg1000 and the Observer team 🙏🏿 Inching closer to that NOV pub date - link in bio to pre-order 📚 (shot by @andrewwoffinden ) - @kenyahunt on Instagram

find somebody better roman alexander over me song look for someone better look for another person

New page update ✨ · · When we first started this page our main goal was to share our favorite non toxic, organic products, and meals that we love! With that being said we’ve grown to share more lifestyle details, style, and room decor. We are going to continue to share or favorite things but our account will be run by @alexiskoutrouba @madison_koutrouba will be moving to North Carolina this coming new year and will be sharing her favorite travel spots and restaurants! @skoutrouba will continue sharing her favorite recipes for her daughter Ruby! We are so excited to continue sharing with you all thank you for following us and supporting our page ✨ - @feedyourmantra on Instagram

gefeliciteerd vlag balonnen verjaardag happy

Summer fields with @badaraofficial #madeinsenegal #martone #escape - @martonecyclingco on Instagram

simtexx simtexx when goatcatto

Posted @withregram • @mariafelldin Härligt luftig roséprovning i solbad. 😎 #coronastyles - @svenska_vinbolaget on Instagram

were not here to talk about that kanye west touch the sky song we have another subject this is not our subject

Happy World Gin Day from the Folkingtons team! We cant wait to be back out on the road and seeing you all over a G&T soon! #worldginday #ginandtonic #gin #tonic #mixers #folkingtons - @folkingtonsdrinks on Instagram

isnt there someone else you can annoy ice age manny

Yuck, you go girl. Strut your stuff girl. You hair looks fresh girl. Always be yourself girl. #instagirl #influencer #promogirl #prettygirl - @dillonpaulette on Instagram

man purple heart fall in love happy

“We neeeeed a Crack Shack in ______________!” ⠀ ⠀ 👆🏼 Heard. Workin’ on it 🐔❤️ - @getcrackshacked on Instagram

sml brooklyn guy find somebody else find someone else supermariologan

Words cannot describe how amazing this beautiful woman is. She is the definition of rock, presence and support. She knows me too well. Knows what I am craving even before I say it. Feels it when Im sad and happy. Shes been my superhuman since day one and I know the woman I am today, is her handiwork. I pray for Gods blessings and grace upon your life. May you age in grace, strength and beauty. I love you so much mother.❣️ Happy mothers day 🌹👑 _ - @ephyah_jojolove on Instagram

what else is there to say nik nocturnal what more should i say is there something we need to talk about

Yesterday with @sjhaya - @miheldt on Instagram

valentines day card ariana grande thank u next

💖just a few drinkipoos - @lele_lj on Instagram

sticker drooling awe admiration adoration

🏕️ Mood pour le week-end ! 🚐 ⁣ Chill dans le van après une belle session. Et vous quel est le programme ? ⁣ .⁣ .⁣ .⁣ .⁣ #thesweettransition #allin #beallin #getcomfortable #hossegorsurf #hossegorbeach #campingsauvage #camping #campinglife #slowliving #surf #poncho #ponchodesurf #surfponcho #chill #chillvibes #chillzone #outdoor #outdoors #outdoorliving #vanlife #combivw #combivolkswagen #vanlovers #foret #foretdeslandes #forest #livinginthewoods #landifornia #van - @allin_the_sweet_transition on Instagram

aceventura satan commonmistake jimcarey landlord

First successful SF delivery! Thanks for the order @keely_shaye - @slodownwines on Instagram

i only want you babyjake touch song its just you that i want youre the only one for me

Back at it.... Excited for 4th July 💪🍔🥩🥃 #macandwild #returnofthemac #4th July #pleasebook #goodmeat #whisky #haigclub #highlandpark #copperdogwhisky #taliskerwhisky #landrover #landroverbar - @calum.mackinnon on Instagram

i dont want you to find somebody else love me only me

#sun #beach #maasvlakte #slufter #snackcorner - @maasvlaktestrand on Instagram

what else do you need aishwarya buzzfeed india what more do you want do you need anything else

Hello foodies, A beautiful Air bar with Mixology Masterpieces is in agra ie. @molecule.agra *It has the best of nightlife *It has a cool and attractive ambience *Different style of drinks *It serves tempting food with craziest and most innovative molecular gastronomy as- ●Dragon smoke peri-peri Popcorn ●Dark sunday ●Edible lava cake ●Chole batture inside out ●Air bread ●Cheese cake ●Punjabi style lamb chops ●Peri-peri and pesto Paneer tikka ●Highway chart ●pizza And many more..... PEOPLE WHO LOVE TO EAT , ARE ALWAYS THE BEST PEOPLE😎❤️ So guys what are you waiting for go, chill and enjoy with your friends and family the new(unique) experience with crazy chemistry experiment with food. Address- E-4, Taj Nagri, phase-2 (Near Hotel Courtyard by Marriott), Sector-E , Fatehabad Road , Agra- 282001. @molecule.agra @taj_gourmets @sahilsambhi @anas.connect @yashsablok #agrawala #agra #india #delhi #tajmahal #mumbai #travel #uttarpradesh #jaipur #incredibleindia #travelgram #travelphotography #photography #rajasthan #wanderlust #love #instagram #noidan #architecture #lucknow #newdelhi #up #indian #tajmahalagra #faridabad #wondersoftheworld #punjab #travelblogger #agrafort #loveforfood - @agra_wala on Instagram

go bother someone else go annoy someone else go disturb someone else go mess with someone else arden myrin

silk skirts مره شكلها انيق على اللبس ومرتب ومريح بعد ومو مقتصره على الرسميه حتى يمديكم تلبسونها مع أي توب وبرضو بتنفع ، شكلها يجنن مثل ماتشوفون . شرايكم فيها؟ - @alnoudl on Instagram

thinking consider considering imagine dreams

Dear friends, Downtown is once again open for all your empanada needs. As always, all government regulations are being followed to the T. Thank you for all your support! - @empanadakitchensd on Instagram

hes playing league with someone else

Glæder mig til at hende her kommer hjem 🥰 - @mikkelbroenderup on Instagram

letter baby bae honey before anyone else

Hello mate 👋 - @vicky.mcclure on Instagram

do you ever wish you were someone else kerry bishe sister molly penny dreadful city of angels do you want to be someone else

Farewell Forest Hill home 👋🏻 You were a right old blast! Thank you to everyone who popped by for coffee, crashed in our spare bed and partied in our living room. Actually nobody ever visited for coffee. The parties were good though! On to the next! - @varold on Instagram

nope dope pope color spin

Starting to miss tuk-tuk days in cambodia, such an eye-opening experience, filled with many everlasting memories, cheers to closing another chapter of life! 🛺 - @vinessa_lucia on Instagram

sounds like someone feels defensive poppy amanda leighton trolls the beat goes on someone is a little defensive

“If you don’t live for something You’ll die for nothing” . . #gcfaitalia #chiglo #chigloworld #Customized #fashiontrend #girlswhotravel #somewhere #beautifuldestinations #travelgirldiary #travelgirl #fashionpost #beautifuldestination #traveller #instatravel #itgirl #travelblogger #fashionigers #traveljournal #travelgirlsgo #travelogue #travellover #fashionigers #womancrush #styleoftheday #styletips #todaysdetails #secondlifestyle #mydailystyle - @chiglo_official on Instagram

that was really interesting addison rae bustle it was something else how odd

Thank you all for the birthday wishes and messages. Having a great day so far. This is 45. #2020 photo by @bentidswell - @jesstidswell on Instagram

sometimes my hands they dont feel like my own james vincent mc morrow red dust canada2015 belongs to someone else

#wunschaufkleber für eine VW T1 Pritsche Umbau - 👁👁 #firmenaufkleber #vwt1 #vwt1bus #vwt1pritsche #vwt1umbau #autoaufkleber #vwboys #simsongewerbepark #staticvw #vwbullit1 #tuningaufkleber #hologrammaufkleber #frontscheibenaufkleber #heckscheibenaufkleber #autodekor #werbeaufkleber #suhl #volkswagent1 @vw_tcr @vwt1mieten @vw.t1.t2.t3.spotting @vwt1fans @vwt1t2singlecab @vw_bulli_parts @vw.t1.t2.t3.spotting @vw_t1_fan @vw.bulli.bus @t1_vw_bus_bulli_side @volkswagen_t1_t2_t3 @volkswagen_t1 @stickerklinik.de - @stickerklinik.de on Instagram

they need something else rahul dua they have other needs there is something they need

London is yours to rediscover from the steps of Ten Trinity Square. Located just a stone’s throw from the city’s most iconic sites, you can take in Tower Bridge, the Tower of London and the River Thames all in a 10-minute bike ride! 🚲 #DreamWithFS #RediscoverLondon 📷 @m.m.v.d.m - @fstentrinity on Instagram

mimi moment mari omori mari mari omori send hwlp

✨ #SOLD ✨ - @montereykangaroopoint on Instagram

phone ringing calling telephone on the other line

Comme un air de vacances à Radio Phénix. Clémence, Benjamin et Hugo terminent sous le soleil leur mission en Service Civique chez nous après une saison riche en émotions et en rires. On a envie de leur dire un grand merci et leur souhaiter que du bonheur pour la suite. Une belle aventure qui prend fin avec un mètre de distance. #Caen #radio #findesaison # Normandie #RadioPhenix - @radiophenix on Instagram

how could i ever love someone else emma heesters drivers license song i cant fallen for someone how can i love someone else

To get in the back-to-school spirit, The Shops at Merrick Park hosted a family-friendly drive through celebration. 250 cars attended and received prizes like book bags, school supplies, gift cards, and promo items. What a great way to safely prepare for back-to-school season! . . . #backtoschool #school #drivethrough #celebration #familyfun #backtoschoolseason - @brookfieldpropertiesretail on Instagram

when the crazy allottl allot all drugs

This weekend last year . 💫 #glastonbury - @tracyclifford1 on Instagram

you should have sat next to someone else michael kit harington modern love you shouldnt be here

Today I visited my good bredda @aron_gullyecho at his work place! Mad ting!!! Besides working for the Children in the City of Zurich, he is the one that built the recording studio where you see me working from when I am in Zurich.🙏🏾 Just like the Calis World Radio Show 📻 that is ON right now every morning from Monday to Friday! We streaming on IG Live and Facebook Live 😁 its a viiiibe and I enjoy listening to some good music with you all. Sooo see you tomorow morning 11am(europe time) for Crazy Wednesday 😜🎶 🔥🔥🔥 #CalisWorldRadio #NewTing #DailyVibes #MorningVibes #Sembelek #BeautifulDay #Zurich - @calipmusic on Instagram

i found someone frank sinatra for once in my life i found my love i got someone

Today marked the first day my dad, my bro and I were able to celebrate a birthday together in about 15 years. We’ve all been through a lot to get to this point, proud of us all. Also popped to some of my fave Orpington spots, so pleased to see Tone Clothing still thriving. X - @julesmhaworth on Instagram

i just think theres better options clash bashing clash of clans better alternatives something else better

✌🏻&💚 - @tysonbarrie4 on Instagram

ruchitabait mtv mtvmentalhealth ecoanxiety the world is a lot right now

Stoked to announce our pals @theadelaideoysterhouse will be on the beach Sunday shucking 🦪! Plus we have more delicious food vendors to announce so come hungry 😃 #bestkindbbq 🌴 - @bestkindbbq on Instagram

drag queen fabulous i didnt kill it someone else did high five

It’s our 1 year anniversary on @balamii today so we’ve gone back to our musical roots n played the best of the 90s n 00s. This is not just any average throwback set. Be there 5-7 Balamii.com x - @lilydawnlondon on Instagram

whoops

4 year anniversary with this sassy babe! 🖤🖤🖤🖤🖤 @alanaleddin - @alantaylor_ on Instagram

jane the virgin petra solano i was hoping it was someone else someone else yael grobglas

The road less traveled 🗺 - @travelfoodlove on Instagram

person girl cute really question

Вся наша жизнь игра и люди в ней актёры. В этой игре мне достался счастливый билет 777, я буквально сорвала джекпот, ведь мне довелось играть свою жизнь в одной пьесе с тобой, Гандольфо❤️ —— ❤️Я благодарю тебя, что ты ЕСТЬ. Такой какой ты есть. ❤️Благодарю тебя, что принимаешь мои трансформации. Я могу быть собой - расслабленной, сильной, заботливой, капризной, весёлой, немного сумасшедшей, уходящей в себя или чересчур открытой, любящей - ты принимаешь меня какая я есть и это самое ценное в отношениях - возможность БЫТЬ СОБОЙ, открывать свою душу. ❤️Благодарю тебя, какой ты ПАПА. Что ты смог им СТАТЬ для Максима и он тебя обожает. А я с трепетом наблюдаю как в нём проявляются твои лучшие черты. ❤️Благодарю тебя за заботу о моих родителях. Мой папа, он очень тебя любил и уважал, и гордился, что я выбрала именно тебя, он всё видит🙏. Моя мама, с каким трепетом она готовит для тебя борщи и блинчики (итальянца накормить - это серьёзно)! А ты всё ешь и просишь добавки🥰 ❤️Благодарю, что ты мой ВОЛШЕБНИК. Ты исполняешь мои мечты. Я помню, как не побоялась озвучить свою мечту в самом начале наших отношений - отпраздновать день рождения с любимым в Париже (до др еще 4 месяца было!). Ты в тот же день купил билеты. В этом так много и ты весь такой, всегда! ❤️Благодарю тебя, что поддерживаешь меня в бизнесе и сам кайфуешь от процесса. Ты знаешь как сильно я люблю детей, всех детей, я люблю быть окружена ими и люблю их сияющие глаза! Дарить им счастье - моя миссия. И ты помогаешь реализовать все мои безумные идеи! ❤️Благодарю тебя, что так вкусно готовишь! Мы были во многих ресторанах мира, но самый вкусный всегда у нас дома! ❤️Благодарю тебя за ТРАДИЦИИ. Для меня это огромная ценность. Сила семьи. Ты виртуозно объединяешь традиции двух стран Италии и России. поддерживаешь, создаёшь новые и принимаешь созданные мной. ❤️Я благодарю тебя за ЛЮБОВЬ. За путешествие наших душ. Я окружена твоей невероятной заботой и любовью. И еще 1000 БЛАГОДАРЮ шёпотом на ушко на рассвете🌅 -- Я счастлива быть с тобой и играть такую важную роль в твоей пьесе. С тобой сбываются мечты, меняется мир вокруг и внутри. Я тебя люблю, Гандольфо. С днём рождения🥳 44 Ti amo Gandolfo. Auguri🎉 @dolce_vitasi - @anastasia__afanasyeva on Instagram

i really need to talk to somebody butters stotch jimmy valmer south park s9e7

B U S Y B U S Y 😝 preparation for this weekend have been a shock to the system with all FOUR coffee units out!! Here’s where to find us... . FRIDAY & SATURDAY NIGHT - George will be at @stanstedpark for a Queen tribute night (Friday) & Proms Spectacular (Saturday) @bel_musicevents 🎶🎤💃 . SATURDAY & SUNDAY - George will then be serving in the morning at @harrysfield 🏕☕️ . Arthur will be serving at @highermoorfarm & @bucklandcampsite 🏕☀️ . Rupert the trailer will be serving at @sunflowerpickingpatch in Fordingbridge . Patsy our Appy will be making her annual appearance at @the_watersports_academy 😍 . I’m pretty sure I haven’t missed anything off🤞🏼have a great weekend everyone!! 😍 - @grounded_dorset on Instagram

someone tell me why jonathan larson andrew garfield tick tick boom louder than words song

🎉🎉🎉 Lucky me! This was SUCH a happy surprise! Thanks you @g_sny and @latimesfood for the write up. We are so happy to be in Pasadena and bringing great wine to you. @vdcwine winery update: construction starts next week! . . . Check out our website and order some great wines. Free local same day delivery or curbside pick up available. 🤞🏻🍷🚚 - @kate.vourvoulis on Instagram

you are asking the wrong person sarah allen fbi most wanted im definitely the wrong person for that ask someone else

ASSADOUL KHADIIM DIEUREDIEUF ✨❤️ - @cheikh_abdou_mouhibbou_hamza on Instagram

play something else stan marsh south park s3e8 two guys naked in a hot tub

Bonjour Bordeaux ! 🤗 Dès aujourd’hui les bordelaises et bordelais peuvent se déplacer en Dott dans les rues de la ville grâce aux 100 trottinettes que nous venons de mettre en service ! 🎉 A très vite en Dott! - @dott_fr on Instagram

drax starts talking thinking of something else not listening

Kicking things back into play: we will be back at @brockleymarket tomorrow ya’ll! 🦵 ⚽️ 🍑 - @subcultsubs on Instagram

is anyone here ms diane choksondik south park hello whos there

https://www.nytimes.com/2019/05/03/obituaries/giuliano-bugialli-dead.html - @andy_ryan_architecture on Instagram

dunder mifflin the office michael scott steve carell flirt

#apecalessino200 #apepiaggioofficial - @apepiaggioo on Instagram

ill see you next time ryan bruce fluff riffs beards and gear so long

- @sarti_so on Instagram

you have to nominate someone else woodrow whyte popbuzz vote someone nominate at least one

Un día de la vuelta de vacas y ya echo de menos Galicia y mi cuñá @reyesiniguez - @chabela_garcia_ on Instagram

youre not the king kay o valorant you are not the master the king is someone else

So if you guys didn’t know, my friends and I @mavismithuk have and are driving 1000 miles from Dover to Edinburgh and then Ben Nevis all in a three wheeled Reliant Robin. We’re doing this for @movember and you can watch/chat and most importantly donate at www.tiltify.com/MAVISMITH @tiltify even if you can only donate a pound. Anything to help mental and physical health. Thanks everyone, it mean my only a lot to me but to the charity themselves. - @matbland on Instagram

im expecting somebody else i wasnt expecting you i was waiting for someone else im waiting for someone else jason bateman

Thanks for all the birthday love! Cheers to 29 🍾🎉 #iamrebeccajordan #rebeccajordanphotography #birthday #weddingphotographer #tampa #hydepark - @iamrebeccajordan on Instagram

where is everyone where everyone go dv dv plays

Nowości @mohitofashion - eleganckie marynarki i dzianinowe sukienki. Na Avanti24.pl znajdziesz produkty warto mieć w szafie! 😍 📷: @mohitofashion #avanti #avanti24 #mohito #ubrania #zakupy #zakupyonline - @avanti_magazyn on Instagram

thats just somebody else pam sistas just another person must be someone else

Today is for the inspirational female winemakers at @jacobscreekwine @prwinemakers #internationalwomensday #iwd2020 @allira.lord @brittsheene #jessbloomfield #jesseymcgowen - @trina_j_smith on Instagram

is someone there mark angel markangelcomedy excuse me cautious

Hola amigos que hablan español, esta publicación és para vos. Recorremos Sudamérica por 8 meses haciendo amigos de distintas culturas y idiomas. Acá en nuestro instagram siempre escribimos todo en portugués, pero notamos que hay mucha gente nueva llegando que habla español (por unas páginas de Argentina que publicaron nuestras fotos, los marcamos acá, gracias!). Así que vamos escribir mas en español en nuestras fotos. Desarrollamos un poco el español en nuestra viaje y ahora también necesitamos entrenar, soñando con los dias que volveremos a las rutas Argentinas, como en esta foto. (Perdón por cualquier error, jajajaja) E em português, só estamos dando boas vindas aos amigos que andam por aqui e que falam espanhol, e explicando que as vezes vamos escrever as legendas em espanhol pra eles também entenderem do que estamos falando :) Agora conta pra gente, deu pra entender o portunhol ali em cima? - @acordaeakombi on Instagram

somebody different william newberry goremiser smite someone else

Clients that make our day! ❤️ Always thankful to these women who believed in us and supported us in the making of SYNONYM. . ~𝚃𝚠𝚘 𝚢𝚎𝚊𝚛𝚜 𝚘𝚏 𝚂𝚢𝚗𝚘𝚗𝚢𝚖~ Shruti Satish in a hand embroidered shift dress at an event in Brooklyn. . . . . . . . . . . . . . #synonym #synonymbyshilpiagrawal #twoyearsold #anniversary #brandanniversary #specialclients #gratitude #clientsofsynonym #clientdiaries #fashiondesigner #indiandesigner #kolkatadesigner #calcuttadesigner #indianwedding #instafashion #indianfashion #fashion #style #supportsmallbusiness #supportindiandesigners - @synonym.clothing on Instagram

whose bed have your boots been under shania twain where have you been sleeping sleeping with someone else cheating on me

Ladies and gents, we are now open again and waiting for you! #500touringclub #firenze #Florence #tuscany #tuscanytour #fiat500 #vintagefiat500 #Repost @collinmcdowell - @500touringclub on Instagram

the crown season2 episode4 netflix find you someone

@ysl ss20 Thank you @samuel_ellis and @arthurmejean ;)! - @l.ucienjones on Instagram

pretending its something else rich benoit rich rebuilds imagine its another thing think of it as some other things

As we step into the next phase of this situation were holding onto the memories of summer and being able to see friends, family, colleagues and clients. Be there as a support to people you know and engage more online in groups, communities and classes. Who knows whats next but stay positive, move with the change and come through the other side. 📸 by @nadilindsay_photography at what was likely to sadly be the last @the_collective_sc event of the year. But what a cracking evening it was. For those of you looking for an award winning English sparkling wine then look no further than @ashlingparksparklingwine it is now one of our favourites. - @kitchmedia on Instagram

god love pastor awesome heart

Dare to live the life you’ve always wanted. . . FOLLOW US @visit_bd IF YOU LIKE TRAVELLING! 💕☮️ . . . . . . . . #instagood #travel #travelblogger #travelphotography #traveling #travels #travelgram #bangladesh #nature #naturephotography #asia #southasia #travelersnotebook #travelguide #traveller #travelphoto #travelasia #travelling #tourist #lonelyplanet #travelporn #travelgoals #traveldiaries #travelguide - @visit_bd on Instagram

mhm what else miss havisham south park pip s4e5

Sharing space and wisdom with the fabulous @mrs.freshcut !!! Yes, I was totally fangirling!! - @libelula_mama_doula on Instagram

think of someone else get over it move on dont be selfish ellie

The team at @here.mag in New York asked me to pull together a list of Melbourne restaurant recommendations that illustrated the citys culinary diversity. Heres where we landed... . . . . #melbourne #travel #foodtraveler #melbournefood #melbournerestaurants #travelaustralia - @tourdeclance on Instagram

dont tell anybody clyde donovan south park s22e5 the scoots

Thank you @drinksinternational @hamishssmith for this recognition. Is an honor for me to be part of this list next to incredible colleagues and mentors 🙏 @therumambassador when we organize a domino tournament? - @carinasoto_velasquez on Instagram

anybody else gabriel iglesias gabe iglesias mr iglesias anyone else

. . . SIGN PAINTING & NEON SIGN for MUGGSY 🍸🍹 . @muggsy1017 . . FINISH UP🌝 . . 暗い街を、世の中を明るく照らそうぜ💡💡💡 . . . #muggsy #bar #cafe #facade #sign #neon #neonsign #classicstyle #signpainting #signpaint #handpainted #handwriting #baumartstudio . - @baum_art_studio on Instagram

tony talks iamtonytalks stranger roommate i dont know her

go mobile! #morekidsonbikes #morekidsfixingbikes - @scottnydam on Instagram

kevin hart you are something

Been listening to #summerskin on loop for days now! Thank you @parekhandsingh for making music that makes you believe. #midday #newrelease #giglife - @kkuenzang on Instagram

anything else butters stotch south park s12e14 the ungroundable

What an incredible Preview Party Day 1 to kick off Thrift Studio! ⠀ ⠀ Swipe through to see a snapshot of the day, and check out our Stories for even more Preview Party fun. 📸⠀ ⠀ Special thanks to our shoppers, sponsors, and volunteers who came ready to shop and support today! ⠀ ⠀ Thrift Studio opens to the public on Friday, August 28 and runs through Saturday, September 26. Located inside The International on Turtle Creek Design Center, Thrift Studio is Dwell with Dignity’s largest annual fundraiser.⠀ ⠀ Shop designer decor and furniture items at least 60% off retail prices. Come get a great deal and support a wonderful cause. We hope to shop with you in person soon! - @dwellwithdignity on Instagram

love yourself before you love someone

#tbt #fusca #fuscabrasil - @d2_mascarenhas on Instagram

you know better than anyone kristen bouchard katja herbers evil the demon of cults

This #WorldOzoneDay , let us all pledge to contribute every bit we can to ‘protect the protector’ of planet #earth 🙏 #ozoneday #ozoneday2020 #aatmanirbharbharat 🚴‍♀️ - @manojtiwari.mp on Instagram

i know im not the only one shea whitney im not alone its not just me theres someone else

- @giojoland on Instagram

well if im being honest the answer is yes travis denning abby song im saying yes i agree

Old town - old ride ⚜️ @barbarabuiofficial . . . #chevrolet #camaro #paris #montmartre #france #photoshoot #shooting #mode #travel #classiccar #v8 #67camaro #barbarabui #fashion #photooftheday #picoftheday #beautiful #instagood - @thesilvercamaro on Instagram

youll find someone else cara theobold alice durand absentia you can find someone else

Pic 1: me and my boyfriend. Pic 2: my dream boyfriend - @lroseprice on Instagram

youre not the only one jhene aiko stranger song theres someone else youre not alone

Thanks to the lovely @mercuryprize folk for bringing our shortlist trophy up to Newcastle on Saturday. 🏆 It almost feels a bit real now. #hyundaimercuryprize #mercuryprize - @lanternsonthelake on Instagram

luck

That time of year again ! FOS #festivalofspeed speed #koenigsegg #supercars #supervettura #hypercars - @neildmr on Instagram

hello bradley hall anyone there is someone there where is everybody

Ultima giornata di Eatinero Codogno - European Street Food Awards! Vi aspettiamo per tutto il giorno in Piazza Cairoli con tutte le specialità dei food truck di 𝗘𝗮𝘁𝗶𝗻𝗲𝗿𝗼.𝗶𝘁! Ricordatevi di votare il vostro preferito @europeanstreetfoodawards 🥳 - @eatinero_official on Instagram

you got somebody else afgan if i dont have your love song kamu punya yang lain kamu bukan milikku seorang

Loving the way the 🚌 turned out thanks to our amazing local artist @jefflavinsky and friends @eideaz. You guys did an amazing job!! Cant wait to take a selfie or 2 this summer at the @sawdustartfestival. . . . #sawdustfestival #art #artist #handmade #mural #spraypaint #vwbus #vw #artshow #artfestival #lagunabeach #california #socal @ocevents @stunewslaguna - @sawdustartcollective on Instagram

is there somebody else travis denning abby song who are you with is there a new new one

- These girls

go to someone else ricky jason sudeikis saturday night live bother someone else

Big congrats on your special day Ed & Lizzy 😘 Disappointed I didn’t see a brown snake, so lucky the wedding was so damn beautiful. Thanks especially to @_browneeee_ who’s speech made me pee my pants. See you at the comedy fest next year doll. w/ @mynameis_ajay & @sammccleery 💙💚💙 . . . . #wedding #country #farm #farmstay #sunset #ipswich #brisbane #qld #queensland #cows #brownsnakes #glamping #cocktails #farmers #love #latergram #countryroads - @carlabellomarino on Instagram

henry stickmin distraction dance pixel art

Un des plaisirs de la reine Elisabeth II ? Conduire elle-même ses voitures, même à 94 ans ! La reine a été vue sur les routes autour de Sandringham au volant de son Range Rover. 🚗 © Abaca #QueenElizabethII #ReineElisabeth #ElisabethII #ElizabethII #Windsor #Theroyalfamily #Queen #Britishroyalfamily @theroyalfamily #Angleterre - @pointdevue on Instagram

someone else coming anthony kongphan arriving someones here stranger

#holidaymood - @laminemusic on Instagram

whose lips have you been kissing shania twain whos bed have your boots been under who have you been kissing who have you been with

Mekhukhu - @u.kwazi on Instagram

im not the only one that you invest in eli derby lately song im not the main one theres someone else

If there’s one way to sum us up, “pack of highlighters’ is that way. Thanks for the wicked review @straightforward_blog ! - @hisiennaband on Instagram

anyone antonia gentry bustle everyone everybody

Crush Festival @howard_vineyard 🍹 - @gemma.borrello on Instagram

i think youre seeing someone else grady smith are you talking to someone else i believe youre dating someone else

Hoy hemos celebrado el 20 Aniversario de los Premios Vogue Belleza !enhorabuena! #premiosvoguebelleza2019 - @sofia_henkart on Instagram

berl berlcosmetics perawatan wajah skincare love

Thank you so much @britishvogue and @alice_cary for this article 🌟 https://www.vogue.co.uk/fashion/article/valentino-spring-summer-2021-alex-andrews-maelona-thomas-models - @alexfromcanvey on Instagram

someone

We’ve been having a lot of fun in the production kitchen lately with new team members like Alexa. 🤗💚 Alexa is a dedicated vegan who is happy to have a food job where she doesn’t have to handle animal products. Have you noticed how beautiful our raw vegan foods and desserts look these days? It’s thanks to Alexa’s creative touch.👏 And, P.S. Have you tried our newest items: trail cookies, banana bread and coconut clusters? They’re so good! 🤤 Let’s hear it for our PJC production team! 🥳🎉 - @pittsburghjuice on Instagram

mhae lurking mhae de witt twitch amhaezing

Vespa & split combo- do you like it?😃 Follow @air.cool.ed 4 cool classics daily. Pics by @sixpack.claassen #t1 #splitbus #t1bus #t1transporter #vwbus #volkswagenbus #transporter #bus #vwbuscamper #bust1 #vwtransporter #vwbust1 #alpvolks #oldtimer #klassiker #bulli #volkswagenbulli #airmighty #vwbulli #aircooledvw #vwbuscamper #camper #campingbus Find more air.cool.ed stuff on: @bugbus - @air.cool.ed on Instagram

you mistook me for someone else boro catherine keener brand new cherry flavor im not the one youre looking for

I had an amazing trip to Ghana. I meet The President of Ghana, a king , some amazing business minds, and the next generation of artists and movers in entertainment. I feel grateful to have had the privilege to experience Ghana and the continent of Africa. I love working @endeavor where they encourage us to think big, stay curious and discover. Being a person of color my homecoming to Africa was very powerful. I’ve traveled to many places but I’ve never been to a place where I was in the majority. I realized On this trip that we all want to tell our story. Life is about stories and dreams. A highlight of the trip was dinner on Thursday night and getting the chance to listen to Ghanaians vision for the future of Ghana, their vision is beautiful and powerful. Thank you @badassboz for bringing me home and for being a great host. I loved hanging with Endeavor peeps @paul1109 @faberindustries @crullmanwalsh @jaymandel - @bellmeadallstar on Instagram

ruin someone elses life queen bean disenchantment destroy others life wreck someone elses life

I had the opportunity to « dress » the new delivery truck 🚚 of @olekacanvas last month. Always nice to see my « art » on different support! 🤗 - @maalin.illustrations on Instagram

friends phoebe buffay maybe theres someone else maybe there is someone else theres somebody else

- @hariss_umerr on Instagram

it came from someone else jerome chef mcelroy south park s6e7 the simpsons already did it

- @silverstallionbicyclecoffee on Instagram

someone else neil degrasse tyson startalk not you some other person

One last morning coffee before grabbing your surf board and catching the Biskaya bay waves. Just vanlife. 📷:@lukas_pousset #crosscamplife #Crosscamp #vanlife #crosscampingtrip #vanlifeeurope #roadtrip #campsite #outdoor #homeiswhereyouparkit #vanderlust #stayandwander - @crosscamp_official on Instagram

what if dont accept someone elses dream as your future organize stickers bright

This photo has to be re-posted with @andros_maximus beautifully poetic sentiments attached. ❤️❤️ “When I was a kid, my mum had a poem on the wall, that me and my brothers used to read almost everyday. Don’t walk behind me, I may not lead Don’t walk in front of me, I may not follow Just walk beside me and be my friend... That message has stuck with us till this day and will always have a huge influence on us. For the last 11 weeks we have walked beside the people you see here (and many others who are missing from this pic) who we consider to be friends, to make a small difference in the lives of those who need it most during what has been a very difficult time for all. In a time where division is rife, let’s try to remember that love and unity will ultimately help us prevail. The mission remains the same. More work to be done @perch.n16 #nosquareinmycircle - @perch.n16 on Instagram

lets pick someone else mr mackey south park s9e7 erection day

En el tercer día de La Cosecha Guatemala visitamos la finca @bellavistacoffee ☕️🇬🇹 , se enfoca en cafés de especialidad tanto de Antigua Guatemala como de otras regiones cafetaleras del país. Para Bellavista, el café es la historia familiar de la familia Zelaya con una finca con alrededor de 100 años de existir. Hoy en día, Bella Vista exporta alrededor de 100 contenedores por año; centrándose en cafés especiales de Antigua Guatemala y otras regiones cafetaleras del país. El impacto de sostenibilidad y desarrollo social abarca diferentes ejes, entre ellos: más de 120 empleados, desarrollo de carreras y oportunidades para su comunidad. 📸: @monodelespacio - @lacosechaguate on Instagram

i think youre seeing someone else grady smith are you talking to someone else i believe youre dating someone else

Erin Foster, perennial bachelor: retired. - @rebeccaannes on Instagram

someone else the simpsons moe hands up hes right

BOSTONIANS: go get the new @justforall ‘Egg’ Sandwich at @cloverfoodlab in Central Square!!! You’re welcome. 🥚🥪 (📷: @vegnews) . . . . . . . #clover #justforall #boston #bostonvegan #vegan #veganaf #vegansofig #veganfoodshare #foodshare #veganfood #veganboston #bostonveganfood #veganfoodie #veg #govegan #bostonma #health #healthy #healthyliving #healthyeating #foodie #food #foodporn #veganfoodporn #goveg #plantbased #vegetarian #vegano #vegan🌱 #bostonveganguide - @bostonveganguide on Instagram

Happy Mother’s Day mommas!! We are doing a lil MOMLINE live streaming show in conjunction with @lilleaeske to celebrate all the mommas and remember what it’s like to play a gig, even if it’s just me and @mcfarflung sitting in our van, strumming some guitars. So tune in to @lilleaeske ‘s Facebook page at 11am (west coast time) for some MOMosas and tunes! 🥂 💜 (if confused about where to see the livestream, check the flyer above) - @aebreeezy on Instagram

Hey, please read our blog post about how the movie #uncorked on #netflix inspired using & how its breaking long-held misconceptions about Black wine drinkers. Dont forget  to subscribe to our website for more updates, Use this link or click link-bio to read: https://bit.ly/3hz8nPB  #winelovers #winestagram #uncorkedtc #winesouthafrica #winebloggers 🍷🍾 - @uncorked_sa on Instagram

Cayucos/Paso Love 2020....#thwinery #dennerwinery #cayucos #magical #family #wine #trust #kayarules #adventure #real #true #live #love #pasowine #surf #beach #reachthebeach #bunnylovesgoats #rondenner - @erikryanrichards on Instagram

Tata Altroz! GOLD STANDARD! . . . . . #autoexpo #altroz #tataaltroz #tatamotors #tata #tataharrier #i20 #autoexpoindia #hatchback #ev #sportscar #carsofinstagram #caroftheday #indiancarhub #tatanexon #tatacars #baleno #swift #fortuner #amity #amitynoida - @indiancarhub on Instagram

A lovely pair. . . . #minisofinstagram #classicmini #minicooper #minicooperregister #rovermini #austinmini #jpmini #automotivephotography #classiccars #classiccaroftheday #mini #britishleyland #leylandmini #britishcars #ukminis #originalmini #britishminiclub #minifest #bluecar #car #minisocial - @the_mini_motion on Instagram

It was #hatsoff #ladiesday @salonpriveuk @blenheimpalace yesterday @touringsuperleggera debuted and looked amazing #carphotography @boodlesjewellery @axa sponsored event - @jasondoddphotos on Instagram

juicy lucy is looking so 😍 today. just a reminder ~saturday brunch~ begins this week, october 3rd 11am-4pm✨ - @thewellborn on Instagram

Let’s the adventure begin 🛺 — #thegira #unconventionaladventure #unconventionaltravel #avventura #travel #adventure #viaggiare #viaggio #italia #mare #viaggi #instatravel #italy #viaggioavventura #outdoor #adventurtravel #travel #travelgram #travelphotography #trip #instatravel #photography #travelblogger #vacanze #travelling #turismo #picoftheday #viaggiaresempre #love #holiday #photooftheday #ınstagood - @thegira.it on Instagram

Sunshine, Aperol, Good Vibes and Nice Music. Come along and enjoy this beautiful Day @schroedingers.hamburg We start now ☀️ #schroedingers #hamburg #akva_music #techno - @akva_music on Instagram

Gettin........ - @hairy_susej on Instagram

This vehicle is called an Avo Veio Avo = Grandmother Veio = Came Grapevine story: Granddaughter was waiting for her grandmother for a very long time. Finally one day she arrived in this vehicle with food and gifts. Ladies and Gents the Avo veio 💁🏾‍♀️ #avóveio #angola #sumbe #luanda🇦🇴 #awesomepicture #followforfollowback #travelling #travelwithme #wetravel #globetrotter #vacations #vacationmode #travelling #traveller #balckwoman #blackwomanmagic #blackgirlmagic #amzing #beautifuldestinations #someinformation #awesomepicture #africanamericanwomen #europeblackgirls #beyonce #touring #blackwomantravel #blackwomantraveltoo #blackwomantravels #cardib #beautifull #blackfeminism - @blackwomantravels on Instagram

On a peut-être poussé le mythe de l’effortless parisien un peu trop loin - @celestaaine on Instagram

Just married ❤️ - @siouxsienomen on Instagram

Hey kombucha lovers well be back at the @solidfloor yard //just off Columbia road flower market// this Sunday. P.S. theres also a rare beauty of a ☀️ terrace! . . . . . . . . . . . . . . . . . . . . . . . #streetfood #streetfoodlondon #columbiaroadflowermarket #columbiaroad #freshflowers #vegan #veganstreetfood #vegansofinsta #londonvegan #veganlondon #vegetarian #veggie #hackney #london #kompassion #kombucha #kombuchaontap #healthygut #guthealth #drinks #mindfuldrinking #lownoalcohol #summer #healthylifestyle #sun #sunterrace #market #streetmarket #columbiaflowermarket - @kompassionkombucha on Instagram

Such an honor to play for @betoorourke‘s crowds and see this amazing campaign at work the last two days in Temple and San Antonio. No special interests, no PACs. The real deal. Go Beto! #betofortexas - @brittdaniel on Instagram

Throwback 3 years ago, at @riadjardinsecret picture by @mouslamrabat 🍟#riadjardinsecret#marrakech#morocco - @cyrielle__rigot on Instagram

Persiapan musim hujan 🐸 - @mlesmana on Instagram

💚💚 . @vintage_lovers_kerala . . . . . . . . DM/Tag us your photos and videos . . . . . . ⭕Follow:@vintage_lovers_kerala . ⭕Follow:@vintage_lovers_kerala . . . . . . . . . . #vintage #lovers #kerala #modified #mallu #mallurider #malluvibes #vintagenature #vintagekerala #vintagelove #vintagemodified #vintagephotography #vintagevibes #modifiedlife #vintagelife #vintagestyle #modifiedlovers #keralavibes #keralagodsowncountry #keralagram #keralaphotography #keralagallery #kerala_360 #keralaattraction #kerala360 #kerala🌴 - @vintage_lovers_kerala on Instagram

@jamievahala and @dallasobserver wrote about us and our new EP, go check it out! #dallasobserver #dallas #nicksnyderandtherealdeal #newmusic #localmusic #rock #blues #srv #hendrix #guitar #supportlocalbusiness #supportlocalartists - @_n.snyder_ on Instagram

Hey guys, excited, nervy and grateful to share that NATE will be coming to Netflix this fall. Hope u enjoy the show. Thanks to @helen_e_shaw for this killer writeup in @nymag / @vulture and thank you to @krlessing for making it happen. Link to article in bio. 📸: @lindsayellary Hair: @rena.calhoun Makeup: @tobyfleischman - @nataliepalamides on Instagram

Rdv ce week-end au @kenny_festival ✊️ Ambiance et plaisir garantis. Retrouvez nos amabassadeurs @flo_sous_le_casque @yannick_dalle et @cross_onlyyyy #kennyfestival #ride - @3as_racing on Instagram

🌅🌅🌅 - @georgie_hmills on Instagram

The pedestrianised area of Winchmore Hill Green has been a total vibe fest all summer. Local businesses bustling, al fresco dining, children playing safely, it’s given N21 a much needed boost of community spirit and positivity, during this miserable year. Now the colder weather is here, the businesses on The Green really need our help! #enfieldcouncil are currently refusing permission for much needed sturdy awnings to keep us sheltered whilst we munch on delicious grub and therefore defeating the object of having the road closed throughout the colder months. So please, take a few moments to give your support to our local businesses by letting Enfield Council know how much you are enjoying our local slice of cafe culture and help secure it’s future (link in our linktr.ee in bio) n21 #winchmorehill #palmersgreen #oakwood #enfield #southgate #winchmorehillmums #oakwoodmums #northlondonmums #grangepark #winchmorehillfamilies #southgatemums #northlondon #winchmorehillandenfield #lovelocal #supportlocal #winchmorehillgreen #enfieldcouncil #cafe #alfresco #hopeforhospitality #saveourcafesandrestaurants #howmanytimeshaveibeenontheenfieldcouncilwebsitethisweek - @winchmore_hill_local.life on Instagram

LOVE WINS Tire o seu preconceito do meu caminho, eu quero passar com meu amor. O Editorial LOVE WINS trouxe a essência da cumplicidade, empatia e união. Sabemos que temos tantas barreiras, preconceito e julgamento a serem vencidas. Mas, acreditamos que no final sim. O Amor Vence! Buscamos um casal real, com uma cerimônia cheia de sentimentos. Pois o importante é, o amor que une! A liberdade de amar a quem quiser e seguimos como igual. Se ousamos falar de AMAR, então que seja por completo e com reciprocidade. Casal - Ricardo & Adolfo @ricardoferreira_007 & @adolforither Idealizadoras - Sabrina & Andressa Assessoria - @estreladomareventos Fotografia - @marsouzafotografia Filmagem - @spindolafilmes Celebrante - @joaosantana_celebrante @casamentoousado Decoração - @bistrodeideiasdecoracoes Móveis -@andrecardosofestas Kombi - @kombigarrafinha Doces - @dreamconfeitariagourmet Bolo - @vanessaregazini_bolos Trajes - @reginanoivascaragua Convites - @convitestalitaromancini Lembrancinhas - @lp_caragua #casarnapraia #casamentoaoarlivre #elopementwedding #casamento2020 #casamentonapraiainspiraçao - @bistrodeideiasdecoracoes on Instagram

“act natural” she said 📸 @sophieiweill - @christina.m.gonzalez on Instagram

on the road again! quick stop to check out #hotspringsnationalpark! love these historic bath houses, wish we could stay and soak! - @ryann_ford on Instagram

Celebrating the luuurve ❤️ #plaudiaontour - @claudhackworth on Instagram

7 years with this incredible human!! Well, of marriage that is. 14 years if you count all the dating and proposing and making sure my hair looked good and breath didn’t stink. Thanks for being my best friend @jenny_delucia. Love you forever! - @stolficomedy on Instagram

Сезон больших свитеров объявляю открытым, даже если в Майами их можно носить только под кондиционером😭😄 #celine#miamilife#modelinmiami#notaswimwearmodel#fall2020 - @as_nastia on Instagram

This is Rajah Caruth 🚗 💨 🏁 at 18 years old, he already has his #nascar license and has a trophy case filled of achievements from around the country. Just like @bubbawallace who Caruth looks up to, he has his own unique journey in the sport 🏁 In the last few weeks I’ve done so many things outside the box like help 20/20 with the Juneteenth special, drop a Juneteenth story and even produced my first all Spanish piece BUT this story is special. I heard about Rajah and his story about a year ago but didn’t know him or how to find him. We never spoke and we didn’t know each other and I never covered #nascar 🏁 but this is the perfect example of “what is meant to be will be” no matter what ✨ it will always be yours 🙏 thank YOU for telling me your story 🏁💨🚗 - @reportercruz on Instagram

@keirstarmer at our Camden Gardens pocket park for @camdenhighline earlier this week, discussing the fantastic work done with the community and volunteer groups. Such a great project to be a part of! @uklabour @camdentown_unlimited @ooodesign @mrhowardmiller . . #camdengardens #camdenhighline #pocketpark #camdentownunlimited #studiomutt #keirstarmer #labourparty #labourpartyuk #architecturephotography #architecturedaily - @studiomutt on Instagram

In case you missed my IG story, I was on @hodinkee the other day in an interview with @cole_pennington ! ✨Link in bio✨Thanks so much for featuring my work and taking a look at my niche little corner of the world. The feedback has been so nice to read and I’m very grateful for the support ! If you’re looking for a new and wonderful world to dive into, some horological history might be the way to go 🕰⏳🕯#horologist #automata #hodinkee . . . . . . . . . . . . #memoriatechnica #craft #antiquarianhorologist #interview #watchmaker #clockmaker #coolkid 😎 - @nicocurio on Instagram

• Milieu Up Skill 9 ADVERTORIAL PHOTO & VIDEOGRAPHY WORKSHOP 📆 Sunday, October 4th, 2020 ⏰ 10.30AM - 03.30PM 💸 TRF Rp 305.000,- (include 2 classes, lunch, voucher & doorpize) 📍 The Canvas (Lv 1) Milieu Space Imam Bonjol st No 27 DR Soetomo Tegalsari Surabaya City East Java • Speakers : √ @mochtret - Mastering Advertorial Photography Part. Studio Lighting √ @angga_rmdhn – Commercial Product Videography with @vespasatya • Model : @c.ceiny from @a.m_models • Property : There will be @sean_wotherspoon Vespa displayed while the event running, and it will also be the object of the practice session • Support : √ @vespasatya √ @plazakamera √ @tokosinarbahagia √ @victoryfotosby √ @ltpro_official √ @studioadventure √ @a.m_models √ @albenayubandal • Information & Registration : Wina Mustika +62 812 3255 5589 • • #milieuupskill9 #vespaphoto #vespaphotocompetition #vespavideo #vespavideocompetition #vespacommunity #vespasatya #milieuspace #milieu #seanwotherspoon #plazakamera #sinarbahagia #victoryfotosby #studioaventure #ammodels #albenayubandal #eventphotosurabaya #eventphotooctober #eventphotosunday #eventphotomilieuspace #eventphotomochrizky #eventphotomochtret #eventphotoanggaramadhan #eventphotopiaggio #eventphotovespa #eventphotocorona #eventphotography #eventphotoindonesia - @eventphotoindonesia on Instagram

A veces tengo días vagos y en general esos días me despierto con ganas de una baguette con huevo revuelto y un café instantáneo, como los que solía desayunar en las ex colonias francesas de África del Oeste en esos puestos sobre la ruta. A mis días vagos los dejo ser, porque nunca tengo más de uno por semana y a veces aparecen incluso menos. Mis días vagos son días de sueño, de series, de aprender algo porque sí, de revolcarme en las banalidades de la vida sonriendo como puerquito en el barro. Me divierten y en estos días reconozco lo que le falta recorrer a mi camino espiritual porque estoy con la mente relajada y enfocada en procrastinar un poquito cada hora. No son días de no hacer nada, son días de hacer con parsimonia y lo que me de la gana más allá de mi agenda estructurada y exigente. Son días de meditar y aprender, pero desordenadamente y lo que yo quiera; de trabajar solo en los proyectos que me apetecen y de ser feliz bajo la ducha, con un buen burrito con curry, vegetales y casancrem y una buena taza de café de mentirita. Se podría decir que son mi domingo aunque a veces caen en lunes, miércoles o jueves. Y me tiro de cabeza a dominguear a mi manera. ¿Cómo son tus días vagos, tus domingos que no son domingos? ¿Cómo los reconoces? ¿Te los permites? ¿Los tienes tanto en viaje como en la quietud del hogar? ¡Me da curiosidad! 😋 #guadaaraoz #domingosquenosondomingos #diasvagos #procrastinar - @guadaaraozweb on Instagram

А я сяду в кабриолет И уеду куда-нибудь🚘❤️ @zemtsovishna - @alenatrusova on Instagram

Good to be back!!! It’s a wrap for today’s ECQ wedding. . . . . . . . . . . #wedding #intimatewedding #preweddingphoto #prewedding #portrait #igers #bride #groom #weddingphotography #preweddings #destination #zoomwedding #weddingsph #prenup #engagement #weddingideas #engagementphotos #weddingphotos #beautiful #destinationphotographer #destinationweddings #fineartphotography #realwedding #philippinewedding #destinationwedding #philippineweddings #weddinginspiration #love #brideandbreakfast #teambenitezphoto - @teambenitezphoto on Instagram

Pre-Iso. Congratulations @pruecottee @ad.mcleod ❤️ - @tomsweep on Instagram

Hello Sunday Times! #singaporerediscover #singaporesidecars #strongertogether #singaporetour #crazyrichasianstour #crazyrichsidecars #vespatour #roadtrip #familyadventure #singaporestaycation - @singaporesidecars on Instagram

wedding tings 👰🏻🤵🏻 #wedding #love - @pbrown23 on Instagram

I want to ride my bicycle 🚲 Fietsen naar het werk is niet alleen gezond, maar ook nog eens goed voor het milieu! Daarom doen de HappyLife-girls vandaag mee aan de #fietsnaarjewerkdag 💃 Wie doet er nog meer mee? #happylifepr #rideyourbike #letsdothis - @happylife_pr on Instagram

31 years later ......as we shed our tears of joy and sadness ... THANK YOU to all our family, our beautiful Brides and their families and friends, and clients over the years, for all the memories and experiences at our “Luxury Salon” location at 141 King William Road. Looking forward to a new chapter where we will continue to create beautiful designs ...handmade with love 💕 - @anastasiabridal on Instagram

Beautiful night celebrating @vbreen1 in my soul city - Big D! #SMU #ponyup 💙❤️💙 - @chesiebreen on Instagram

@readingwearingrocking how is it you always manage to make me look (and feel) like Rock & Roll royalty! Also Alice and my first official portrait together! Oh hey @tomclarknyc check it out representing #thetreehouse2a - @cherylemakeup on Instagram

Super girls. One tired, the other two sweet. #camping #daughtersareawesome #moab #arches #shenandoahspecial #blundstones - @mammahunny on Instagram

I’m back with my first blog post in over a year! It’s been amazing being a full time mom but I’ve missed this. Link in bio to my guide to #temecula wine country! 🍷🍷🍷🍇🍇🍇 - @veggiesandvino_ on Instagram

#ambassador #classic - @ambassadorclass on Instagram

69 Concert dels Cors de Clavé a #LaMercè #Barcelona @bcn_culturapopular #SomCorsClavé - @corsclave on Instagram

A couple of roosters on the cover of the latest @cyclistaus magazine. Read @jacklynchstagram ‘s story on the @letapeaustralia 2020 route and how we were almost feather dusters. 📷 @trentvanderjagt - @spence.spencer on Instagram

Typh Barrow aussi proche que possible de son public #irf20 - @scenesbelges on Instagram

本日は COOPER DAY 🚗💕 今週末はMINI船橋でクラシックミニを展示予定です✨✨ 皆さまのお越しをお待ちしております💐 #cooperday2020 #0908 #クラシックミニ #MINI船橋 #minifunabashi #ミニクーパー #MINIのある生活 #minilife - @mini.funabashi on Instagram

Birthday lunch with the girl! Happy 30th to my wife to be 🎉😘 - @tim_sea on Instagram

rejoice! 🥳 a new single from @dentmay is out now... listen to ‘easier said than done’ & pre-order his album ‘late checkout’ which is out sooooo soon, link in bio! - @carparkrecords on Instagram

#AstonMartinZagato - @aschots on Instagram

Those fog lambs🤩 . . . . #hindustanmotorshm #aocx - @hindustanmotors.hm on Instagram

Fabulous drive up to Castaic & box lunch catered with the theme “decorate your whale”... I don’t have a whale so table, chairs & flowers a must! - @lynnreuel on Instagram

Every 2 years I get pregnant and drink a Fanta. - @daphnejavitch on Instagram

Friday was special in so many ways... thanks to the whole team @soelleroed_kro for a great lunch! Thanks @brianmarkhansen and @janrestorff 🙏🏻 - @torstenvildgaard on Instagram

🌷LUIGI FEDELE GENEA ELFO 🌷vedi➡️🌷Genea made the sculptures 🌷 🌷🌷🌷🌷🌷🌷sculptures # @genea_lardini🌷🌷🌷🌷 🌷Foto @francescatilio 🌷🌷🌷🌷🌷🌷🌷🌷 0 menswear #mens #handmade #menstyle #outfit #sartorial #luxory #class #mensfashion #pitti #bespoke #sartoria #dandy #style #madeinitaly #classic #fashion #jacket #blazer #wearinglardini #gabrielepasini#nickwooster #galles #lardiniofficial #lardinidonna #lardini #lockdown - @lardiniluigi on Instagram

- gerobak

Beach week! 🦞 - @nancyhoggcollins on Instagram

- Chloe Norgaard

Introducing our very own honey, Ballykneidel Honey, now safely in jars, labelled and decorated with honey coloured ribbons thanks to our Beenitah Family Production Line which was in action today. #challahdaddy filled the jars, #challahgirl closed the jars, #challahboy labelled them as he had designed the labels himself and I tied on the ribbons! Thank you for all your help! We are delighted with our pretty jars of honey, right in time for the Jewish New Year, and so pleased to have learned so much about beekeeping this last year. Grateful thanks always to our 🐝 and Niall @eastcorkbees. My dress by @lovetheflamingo. #allegrabenitah #challahmummy #allegraloves #allegralovesbees #honey #bees #beekeeping #beekeeperintraining #roshhashana #roshhashanah - @allegrabenitah on Instagram

Guess who is turning 50. Happy birthday Eliza. I would not want to grow old with anyone else - @markabuckner on Instagram

Me telling Delphi all about the new @gucci eyewear 👀🕶 - @lawrence.perry_ on Instagram

◽️LOEWE   📲 Follow us for more updates   📌Tag us to get featured     #loewecommunity        #love #Luxury #jwa #tweegram #photooftheday #loewe #amazing #outfit #follow4follow #like4like #look #instalike #igers #picoftheday #food #instadaily #outfit #followme #fashion #instagood #bestoftheday #designer #instago #all_shots #follow #colorful #style #art - @loewecommunity on Instagram

Our Mothers will be proud ! We made it to our local newspapers 📰🗞️ Talking about music productions, djing and recording new music in Kenya, catch us closing @houtfestivalhaarlem this Sunday in our Hometown 🏡!!! , free entrance #djing #musicproducers #haarlem #sunshineboys #umoja #trotsemoeders #tourlife - @umojamusic on Instagram

2015 Maruti Wagon R VXI KM 48,000 only Service book ,2nd key ,available Main glass replacement Rs . 3 lakh asking - @f1_automotive on Instagram

I think we’ll make driveway tea parties a regular thing. #lockdown #teatime #socialdistancing - @stephenkelmanwriter on Instagram

Ons personeel staat elke dag klaar om gasten te ontvangen en te bedienen. Onze topper Ahmjad heeft er in ieder geval al zin in!⁠ ⁠ Zien wij jou ook vanavond? Reserveren kan via de website of op ons telefoonnummer 020-7768055.⁠ ⁠ #libanesetaste #lebaneserestaurant #hospitality #haveagoodevening #treatyourself #medditerraneanfood #mazza #shareddining #dineandlounge #sitbackandeat #enjoythediner - @fenicieamsterdam on Instagram

Come by @shopclarev @montecitocountrymart to see Clare, myself and our super cute team! #popping #cutenewdresssalert #summerdaze - @greta_cvshop on Instagram

Another day at the office - @martenlewin on Instagram

We seem to have a spy in our midst but Mr Bond seems a shadow of his former self! #db5 #astonmartin #bondcars #carspotting #classiccarspotting #loveclassics - @petrolheadswelcome on Instagram

Jasmine we totally agree what a great outfit! #twinning #repost @jasmineminogue ・・・ Found my perfect car today 💜 #londonclassiccarshow #astonmartin #purple - @amocarea12 on Instagram

Happy birthday, Peter! So happy to have you by my side all these years, even when you outdress me at weddings. First pic by @marniecornellphotography Go-kart by @wayneman22 - @isabluey on Instagram

A friend‘s car and a friend’s hotel 😻🍾 #blessed #gratitude #friendship #fun #bespoke - @diehmbespoke on Instagram

Make a stunning statement in an romantic, feminine & effortless wrap skirt 😍⠀⠀⠀⠀⠀⠀⠀⠀⠀ Outfit goals by @adrianapaniaguaof ✨ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ .⠀⠀⠀⠀⠀⠀⠀⠀⠀ .⠀⠀⠀⠀⠀⠀⠀⠀⠀ #ATouchOfEspecia #LongSkirts #PrintedSkirts #FloralSkirts #PrintedFloralSkirts #SkirtsForWomen #ClassySkirts #Ruffles - @especiapap on Instagram

BEYOND ECSTATIC for my friend @sallyholmes the NEW EDITOR IN CHIEF!!!!!!! OF @marieclairemag!!!!!! Sally is proof that sometimes corporations CAN get it right and actually promote the smart and wonderfully talented people who work there!!!!! Media has had a rough go of it this summer BUT THIS IS GOOD NEWS!!!!!!! I love you sally 😭😭 - @nikkiogun on Instagram

Zo ziet een selfie met een dertienjarige op vakantie eruit...😒 - @maschalammes on Instagram

Vintage car / vintage people / vintage life vs digital era, let’s go back! Something for next year, too early for details, workin on it 🙏❤️ roadtrippin with @jasper.djosa , @joelhempenius and @kevinneyofficial #wearefamily #rotterdam #theseed #vintagecars #citroën #analogpeople #digitalworld #rushhourstore #rushhourmusic #voyage #roadtrip - @arpfrique on Instagram

2770 ab Urbe condita carrying fathers on the back - @ringfilm on Instagram

If you’ve had to put an at-home event on hold, no need to stress. Contact us today about hosting your engagement party, baby shower or birthday celebration at Lightspace ✨We can host up to 100 people in our warehouse which coincidentally is ten times as many as you can have at home. Contact us today. Photography by @talltimberstudio . . . . . . . . . . . #lightspace #lightspacebrisbane #fortitudevalley #weddingvenue #weddingvenuebrisbane #brisbaneweddingvenue #brisbaneweddings #brisbaneeventhire #eventspacebrisbane #brisbaneeventspace #weddingsbrisbane #partyvenuebrisbane #venuehirebrisbane #brisbanevenuehire #brisbanepartyvenue #brisbaneweddingvenues #eventspacebrisbane #brisbaneeventspace #eventsbrisbane #brisbaneevents #eventhirebrisbane #weddingdesign #weddingideas #birthdaypartiesbrisbane #celebrationsbrisbane #brisbaneeventvenues #partyspacebrisbane - @lightspacebrisbane on Instagram

Phenomenal drivers. Super scribes. Together, an incredible team! Cheers, Hornazd and Renuka!! - @bky911 on Instagram

Retro bunting for my birthday party. It instantly gives a campsite festival feels. . Send me an email for a quote. #bunting #bespokeshop #festivalvibes #bohobunting #bespokebunting #retrobunting #custombuntingflag #buntingflag #bespokeflag #bespokefestival - @bespokeshop.aimee on Instagram

Bei uns bleibt der #bierpreis gleich... 🍺🍺🤗🍺🍺 #bier #bayern #biergarten #bild #heimat #ayinger #ayingerbrewery #ayingerprivatbrauerei - @ayingerbraustuberl on Instagram

Bentley GT #rangerover velar @onyxaacalicut #hayabusa #sbkindia #sbkkerala #calicutcars#malappuram#malappuramkaar#malappuramcars#kannurcars #kannurcarnival #kannurcarlovers#kannurdiaries #kannurian #kannurphotos #kannurtourism#thalasserydiaries#kozhikkoden #keralacars @eisk11 @eisk__10 @eis_malappuram @exotic_kerala @eisk77 @eisk__12 @eis_kannur @eisk57__ @eisk @justcarnbikes - @minshid_k on Instagram

Sometimes all you need for #instanthappiness is a scoop of Salted Caramel and Pistachio Gelato #gelati #gelato #icecream - @gelati.london on Instagram

What a weekend, thank you all who came through reminiscing about @seahearnow and what we all were looking forward to in 2021!! #seahearnow #positivevibes seahearnow2021 #dannyclinch #community - @transparentclinch on Instagram

📍Το καφέ της Χρυσάνθης. Βρίσκεται στην επαρχία Λάρνακας. Το καφέ που δίνει μια ιδιαίτερη νότα στην πόλη. Έχει υπέροχα φαγητά, γλυκά και ροφήματα. Υπέροχη ανανεωμένη διακόσμηση με νότες από παλαιότερες δεκαετίες. Η αγάπη και το μεράκι διαπερνούν από την πρώτη στιγμή που συναντάς τον χώρο. ▪️ ▪️ ▪️ photo by @tokafetischrysanthis Thank you 🙏😊 #tokafetischrysanthis #larnaca_city #larnaka #cyprus #vintage #vintagephoto #amazingplace #coffee #food #larnaca - @heart.destination on Instagram

Following @manonlagreve around the streets of London in her romantic floral look. 🌷 Wearing the Oh So Fine Necklace in yellow gold. #icon #pearlnecklace #pearljewellery #necklace #modernjewellery - @oliviaandpearl on Instagram

Put your money where your mouth is y’all. If you got anything to share share it with these folks! Love to my siblings for setting this up 💕 https://gf.me/u/yajudd - @freefereal on Instagram

Abi 2020 🎓 - @luugner on Instagram

Ecco a voi alcuni scatti ufficiali della 34° @bikerfestint 2020! 🤩 #bikerfestlignano #bikerfestint #bikerfestinternational #lignanosabbiadoro #italianbikeweek #bikeshow #motorcycles #moto #americancar #kustomstyle #show #lignanoholidays #motoraduno #lignanosabbiadorooffiacial #offroad #demoride #music #gardentractor #conferences #vespa #moped #enduro #dirttrack #scrambler #jeep #emobility #paratadelleluci - @bikerfestint on Instagram

Great team and even better photobomb by @rmcenac #leeindustries #timelesslee50 - @russell.towner on Instagram

Looking for a car that can pack more of what you love in? You’re in luck. The MINI Countryman has 450 litres of boot space, which can be expanded to 1,390 litres when the rear seats are down. #MINI #MINIUK #MINICountryman #Countryman #Space #Sytner #Travel #Explore #Adventure - @sytner_mini on Instagram

That @mercuryprize shortlist trophy sure suits @lanternsonthelake 🤩 Whether it’s the first time you listen to it or the hundredth time, hit play on Spook The Herd now. #hyundaimercuryprize #mercuryprize - @sentricmusic on Instagram

#magicnight #fucking60 📸 @christine_gornowicz - @mimmav on Instagram

About Last Night! #tomfordsunglasses #lisaconradjewlry #bohonolajewelry #aliceandolivia #kikirisa #frenchsole #ragandbone #loveoffashion #girlfriendsareforever #friendsthatshoptogether #nieces❤️ - @melanieperret on Instagram

Hoy se cumple un año de mi último día de genuina felicidad... 9 de enero de 2019... mañana hace un año le diagnosticaban a mi mamá un cancer terminal que se la llevó como un rayo en tan solo un mes y 9 días. Nada volvió a ser igual desde el 10 de enero de 2019. Cuando me preguntan lo describo como una sensación mixta entre ‘nos atropelló un camión’ y ‘la pude despedir’. Agradezco habernos expresado tanto amor en vida. Se que nos hicimos lo más felices posible. Me queda ese consuelo, ese oxigeno que día a día hace la diferencia. Mi persona más amada, mi mejor amiga, mi alma gemela, ese amor tan puro e incondicional. Solo nosotras sabemos cuando nos amamos. Siempre pensé que iba a ser imposible vivir en un mundo sin vos pero cuando te fuiste supe que tenía que honrar la vida que me diste con la felicidad que vos hubieses querido para mí. Pensar en eso y en lo positiva que vos eras ante cualquier situación, me saca una sonrisa instantánea. A las decenas de personas que nos ayudaron en ese mes de pura lucha con ella, sepan que nunca voy a tener las palabras suficientes para agradecerles todo lo que hicieron por mi mamá. Están en un lugar muy especial de mi corazón. Me enseñaron a ser mejor persona. A los que me cuidaron en este dificilísimo año con toneladas de amor y empatía... estoy parada gracias a ustedes. Me dieron una energía para seguir adelante que realmente no tenía. Saben quienes son y saben cuanto los amo! A los que hicieron todo lo contrario, les deseo que la próxima vez que puedan ayudar a alguien que realmente lo necesita logren abordar la situación de otra manera. Siempre hay segundas oportunidades para dar amor ❤️ - @cecimendezzz on Instagram

My good pal Max drives this car.. - @johnkastner on Instagram

ARSUN Drops Compelling New Track ‘Lay Me Down’ / Review by Ava Liversidge / Link in bio #arsun - @californiarocker on Instagram

io e tu - @martinafinazzi on Instagram

Passeando pela ruas do Casco Antiguo encontrei esse interessante veículo. Muito bom e prático para circular nas estreitas ruas do centro histórico panamenho. ----------------------------------------------- Strolling through the streets of Casco Antiguo I found this interesting vehicle. Very good and practical to move around the narrow streets of the historic Panamanian center. - @abreusfabio on Instagram

I spoke to @fashionista_com about how I got into journalism, why I tackle supply chain investigations and what the difference is between reporting and activism. Thank you to @unwrinkling for such thoughtful questions! Link in bio. - - - #journalism #fashionjournalist #supplychain #fashionworld #nytimesfashion #newyorktimes #mediamentor #reporting #mediaproduction - @elizabethcpaton on Instagram

#Repost @anaktambang • • • • • • Harga batu bara termal Newcastle untuk kontrak yang aktif diperdagangkan masih lanjut menguat kemarin, Rabu (23/9/2020). Kini harga batu bara semakin dekati level US$ 60/ton. Harga batu bara ditutup menguat 0,42% ke US$ 59,4/ton. Batu bara menguat dalam tujuh hari perdagangan secara beruntun dan kini menjadi level tertinggi sejak lima bulan terakhir atau tepatnya sejak 14 April 2020. Lumayan ada kabar baik. Walaupun gak tau kedepan apakah bisa terus naik atau minimal bertahanlah. . . #anaktambang #tambangupdate #duniatambang - @tambang.update on Instagram

Con las brujas del Crew dandole Color en la #Curura 😜😂🤘🏾🤙🏽🌊 📣Mañana se viene concursoooo!!!! ATENTIS !! #CasaDesciende #volkswagen #combi #combilovers #kombie #kombilovers #supschool #standuppaddle #suppaddleboard @desciendeapneafreediving @nogadiseno @nomade_sports @quinteromasturismo @intisurfcoffee @cland.magazine @zv.prod @domos.quintero - @quinterosup on Instagram

@aldomartins_bcn #photoshoot with @mariapalmlyduch, @bertapfirsich, @susanaxsanchez, @robertgasco, @nuria_bis - @dianabada on Instagram

- @fiat_premierpadmini007 on Instagram

Summer is in full stride for Hello Penny Bar. It is certainly wedding season in so-cal. We tend to surround ourselves with Moscow mules and margaritas. Cheers to all our fabulous clients who decide to party with the best bar in town. - @hellopennybar on Instagram

Revista remix dmode 242 #Mustang con @juanavialeoficial y @lucabonomi_ junto a @fordargentina en el @herenciacustomgarage Gracias a @federicobonomi67 @cynthiakern y @rarigane1 #FordMustang #MustangRemix #mustang2020 - @revistaremix on Instagram

Open from 12pm. Deliveries from 5pm. Boronia ‘extreme delivery’ tonight. #southindian #babajiskitchen #dandenongranges #belgrave #eatdandenongranges #villagecooks #melbournefoodies #melbournefood #boronia #tecoma #kilsyth #upwey #selby - @babajiskitchen on Instagram

Mais um dia de Guided Tours com Atlanticsecretstours.com - @atlanticsecrets2018 on Instagram

OYE MUJER had its world premiere today in @voguebrasil!!! Thank you @laisfranklin for your words and for featuring women and artists of diverse backgrounds from different parts of the world. . . Listen to the full record exclusively here until Friday and readthe full article in Portuguese or English. Link in bio. . . . . Photo: @yaninamayphotography Direction: @myellislife Select pieces worn by LADAMA: @indigoapparelny . . #oyemujer2020 #ladamamproject #ladamamusic - @saritalucas on Instagram

Splendid yet practical, a light bodied #rollsroyce 25/30 HP like this Freestone&Webb sports saloon is an affordable entry in the quality coachbuilt prewar club. Not too formal and supremely elegant, at ease even in the narrow #lakecomo roads for a drink at #dalucianolaglio Thanks @fabrizio_taiana ! #rollsroycemotorcars #freestoneandwebb #prewarcar #coachbuilt - @marcomakaus on Instagram

Pajero Sport EXEDY CLUTCH KIT #exedyindia #exedy #exedyracing #skodaindia #uberwerkstatt #jgarage #coimbatore #cochin #chennai #bangalore #delhi #hyderabad #octavia #bilstein #staytunedindia #mitsubushiindia #vrsindia #bbsindia #bremboindia #petestuned #petesautomotive #milltek #ebcindia #bilsteinindia #madrasmotorracetrack #mmrt #karispeedway #hondaindia #skodavrsindia - @uberwerkstatt on Instagram

Excellent to have @keirstarmer visit our pocket park at Camden Gardens this week! 👏 Whilst down at the space, we had the opportunity to discuss the community ethos of the Camden Highline 🧡 And explain how it fits into our wider plans for a more connected North London 🔗 Exciting announcements coming soon! 👀 - @pitkeathley on Instagram

ROAD TRIP - @lilybinthehouse on Instagram

#obidi_marcellaboidi - @enricofordiani on Instagram

#regram @washy_vw #campervan #vw #vwlife #volkswagencampervans #vwlove #volkswagen #classicvw #vwcamper #vwvans #vwbus #aircooled #vintage #vwlifestyle - @volkswagencampervans on Instagram

Didn’t see Chip & Jo but still had a grat tim 🌿✨ #onthereag #magnoliamarket - @reaganwright_ on Instagram

Becca took her moggy Lionel to visit her old school this week! #morrisminor #mmoc #mmocym #mmocni #classic #retro #vintage #car #carsofinstagram - @mmocni on Instagram

Easy Rider #vespaprimavera#et3 - @co7o on Instagram

F A M I L Y F I R S T 💙 #familygoals #stbarth #vacances #papaetmamanheureux #minimoke #mokestbarths #grandfond #fwi #caraibes - @thomasgibergues on Instagram

6 years married to this beautiful soul! I love you more than you’ll ever know my Lisa! @lisa.morris_ #thebackbone • P.S. she’s still punching though! - @tipo_morris on Instagram

Recently loaned against this vintage Triumph Spitfire - Snapped 📷 here in front of our Worthing branch with Doug Newman Snr overseeing the deal. #triumph #vintagecar #spitfire #worthing #jeweller #pawnbrokers #cars #loan #cash #carsforsale #sussex #deals #dad #gapawnbrokers #poshpawn #poshpawnbrokers - @gapawnbrokers on Instagram

Amsterdam met mijn zusje ❤️❤️ - @goossens21 on Instagram

My little sister got married today and I could not be happier! ❤️ - @maxwilliam_music on Instagram

📷@brendanfallis #puglia #italy #pugliadiscoverytravel #yallerspuglia #volgoitalia #volgopuglia #pouille #apulia #apulien #italie #southitaly #pugliamia #pugliagram #sea #seaside #sun #beach #instago #instagood #instatravel #italia #instalike #igtravel #apuliasensation #pugliaview #weareinpuglia - @pugliadiscoverytravel on Instagram

#2002sday #throwback! Socially distant 02s at Socal Vintage 2018. What will we do this year @socalvintagebmw? . . . . . . . . . . . . . . . #bmw2002 #bmwvintage #bmwclassic #neueklasse #bmwcca #bmwccala #vintagebmw #vintagecarsdaily #classiccarsdaily #carstagram #classicbmw #carstagram #bmwgirl #losangeles #california #californiacars #vintagecarworld #girlswhodrive #carsofinstagram #bmwgirls #classiccars #drivevintage #vintage #bmwroundie #bmw2002faq #bmw #vintagebmw - @laneladylane on Instagram

Check out #IlluminationPR client, @virtualwhiterabbit, featured on @forbes! - @illuminationpr on Instagram

Legend 💛 - @morganetatiana on Instagram

Happiest of birthdays to the most amazing, strongest, funniest and beautiful girl I know! She’s the one who makes my life that much better everyday and deserves nothing but the best for her day! Love you forever girl!! - @timmygage on Instagram

To the moon and back 🌙 • • My beautiful customer @sophierosestrang designed this jumper to give to her wonderful mum, Fiona. I love this so, so much. Thank you for the gorgeous photos Sophie 💛 xxxx - @sayitwiththread on Instagram

Our next featured vendor is the one and only @blackbarrelbar! This renovated Airstream mobile bar shed its shiny sheen and traded its camping gear for cocktail glasses last year. They shake and stir cocktails for events ranging from corporate events, fundraisers, birthday parties, wedding nuptials, and neighborhood gatherings – or any other celebration that requires good booze and good fun. They also offer special pricing for our clients who choose to use them for their second bar! • • • #theunionpavilion #blackbarrelbar #grandrapids #grandrapidsmi #wedding #mobilebar #airstream #eventbar #cheers #weddinginspiration - @unionatrailside on Instagram

It’s going to be a great day out at our event this Sunday, 7th April. We have so many activities and awesome live music... We are super pumped!! And the weather is TOTALLY turning it on for us with a sunny 24 degrees forecast. So make sure you bring some sunshade as we are out in a big open paddock, pack some sunscreen and a hat and we’ll do the rest!! Find our event on Facebook to see EVERYTHING and EVERYBODY who’ll be there. It’s going to be a big one! Sunday Sessions at the Briars. This Sunday from 11am-5pm. Entry is free and parking by a gold coin donation. Proudly brought to you by @bayeventsaus 🎼 📸 @jessicashepherdphotography #sundaysessionsatthebriars #thebriars #mtmartha #mornington #mteliza #dromana #safetybeach #tyabb #baxter #somerville #visitmorningtonpeninsula #morningtonpeninsulakids #morningtonpeninsulamums #peninsulakids #sundayfunday #discovermorningtonpeninsula #bayevents #lovelocal #supportlocal #melbournewithkids #lovewhereyoulive #bayeventsaus #findyourwaymorningtonpeninsula #sunsmart #funinthesun #bringshade - @sundaysessionsbriars on Instagram

Great night at work Greek Street for the Midnight Oil Concert. Greekstreetfoodtruckaus# slowcooked#charcoal#chicken#lamb#fetta#tomato##spanish onion# - @greekstreetfoodtruckaus on Instagram

Fortuner.lover786 follow for shutout 👇 And more exciting video . . Double tap and follow my account @fortuner.lover786 @fortuner.lover786 @fortuner.lover786 DM me your car pic and video and keep supporting . #fortuner #fortunerclub #scorpio #scorpiolovers #landroverdiscovery2 - @fortuner.lover786 on Instagram

Want to rep merch from your favorite new coffee shop? Pick up the world’s comfiest t-shirt next time you stop by! Each shirt design comes in both dark grey and white. // Open today until 3pm ☕️ - @setlancoffee on Instagram

Here we go. - @victoursjamaica on Instagram

Lovely afternoon picnic with a beautiful sunset...what an experience. Good wine, Good food, 5 star accommodation.#janharmsgatexperience#winetasting#backlandsdrive#swellendamtourism - @southernviewnature on Instagram

Apoio no receptivo dos passageiros, dando aquela forcinha para um cliente de peso. Trabalho com responsabilidade, compromisso e pontualidade sempre ! 👊🏽👊🏽👊🏽 #vancâmera #vanexecutiva #executivo #receptivo #photo #film #suport #drive #stunt #externa - @brancotransportes on Instagram

Bei uns können Sie Fahrräder mieten und die wunderschöne Stadt Potsdam mit allen seinen Sehenswürdigkeiten bequem und umweltfreundlich erkunden! 🚴‍♂️🚴‍♀️Wenn Sie bereits mit dem Fahrrad anreisen, halten wir in unsere Tiefgarage Stellplätze für Sie bereit. #hotelamjägertor #explorepotsdam #potsdamentdecken #mitfahrradunterwegs #fahrradwochenende #fahrradwochenendeinpotsdam #potsdammitfahrrad - @hotel_am_jaegertor on Instagram

LOVE THIS @daisyedgarjones for @jimmychoo 🔥🔥🔥🔥🔥💋 - @amandakyme_consultancy on Instagram

Volkswagen T1 Bus spotted in Zagreb, Croatia Owner: ??? #vw #t1 #bus #zagreb #croatia #croatiafulloflife #vagened @vagened - @vagened on Instagram

Educated and fun. Serious but not pretentious. Our team is passionate about our wines and they strive to make every guest feel welcomed. Our tasting room is reflective not only of our wines but of who we are as a team. We look forward to hosting you at the Malene Scene. Visit www.malenewines.com/visit to schedule an appointment. - @malenewines on Instagram

A little light at the end of a long dark tunnel. Honoured @marinagpoloughlin ❤️ - @campaniaandjones on Instagram

Good bye family ❤️ Off to Goa with a new hope.... #football⚽️ #ISL #atkmb #pk20 🙏 - @pritamkotal20 on Instagram

Many thanks to @broadsheet_syd for doing such a great job with this Article...check out the link in Bio! - @superior.burger on Instagram

Enjoyed my camping trip so much that I cant wait to get back on the open road again soon. Exploring a few hours outside of LA felt like heaven. Havent been anywhere since February! I will say we didnt see a lot of people and we were also very safe in how we traveled. I think it is important to be in touch with nature right now. Enjoying my coffee in the middle of nowhere was so serene. Take me back @travelwithmeaning @schibel ❤️👏 Join in on the next one- check out TWM #roadtrips at travelwithmeaning.com #travelwell #openroad #nuturenature #love #togetherwegrow #travelwithmeaning - @girliegreen1 on Instagram

Change of plan..... who said working in events was boring? We WILL be at the new Crystal Palace Park Food Market tomorrow (Sunday 27th) @crystalpalaceparkmkt We’ll be there serving English wines @greyfriarsvineyard a few cocktails and we might crack the urn out for a hot serve! Find us at the Thicket Road entrance on the EAST side of the park from 10am - 4pm. Pop along, grab some street food, a drink and say hello! ⬇️ Tags⬇️ #maverickbarcompany #followfranc #barhire #mobilebarhire #mobilebarhirelondon #popupbar #mobilebar #gbwine #gbwinery #greyfriarsvineyard #greyfriarsvineyardwinery #greyfriarsvineyard #greyfriarsvineyardenglishsparklingwine #crystalpalace #crystalpalacepark #crystalpalacemums #crystalpalacefoodie #southeastlondon #londonfoodblogger #londonfood #londonfoodie #londonfoodies #crystalpalacelondon #crystalpalacemarket #crystalpalacefoodmarket #crystalpalaceparkmkt #cocktailvan #citroënfanphoto #citroenfanphoto - @maverickbarcompany on Instagram

We’re social distancing on the stoop tonight - @davidelliotsoll on Instagram

I think I found a #bonita in #miami 😈.. : : 📸 @memorablej #bonita #miami #nevrmind - @nevrmind on Instagram

NYTT NUMMER UTE NU! Intervjuer med Esther, Ava Max, Corey Taylor, Bob Mould, Amaranthe, IDLES, Ellen Sundberg - Artist, Hanna Järver, Gustaf & Viktor Norén, Faal, Louise Lemón, Ricky Rich, Felicia Takman, Initiates, Spunsugar, Zikai, Division of Laura Lee och Katarina Wennstam! PLUS krönikor, låttips, massor av skivrecensioner och en VÄRLDENS BÄSTA LÅT med Eurythmics! 68 sidor musik – helt gratis! Här hittar du magasinet: https://gaffa.se/distributors Vill du stötta oss med en prenumeration, kika hit: https://gaffa.se/signup/select-subscription Foto: Johan Bergmark #haffadingaffa - @gaffa.se on Instagram

👑🙏 - @killraj_machhar on Instagram

wer sitzt, hat nichts anderes zu tun, als zu konsumieren und zu denken. wer tanzt verbrennt kalorien und gedanken. think about it, why we are still not officially able to #dance and #letgo danke, dass wenigsten am wasser was passiert(e): an der #donau beim @dastechnocafe stream, auf @worldtrash.foundation @pennyfox.me böötle called walfried und beim #traum #openair restaurant @himmelundwasser1 gab’s #sunnyvibes & #sunnysounds fürs gemüt!. am #donaukanal geht sowieso die ärgste #nullzentimeterabstand #noconscious #feierei ab bzw zeigen das auch verschmutze badestege an der #Donau. wäre schon gescheiter, legale #openairs und mögliche #raves mit platz zu erlauben zwecks #trash und #safety @stadtwien @bundeskanzleramt.gv.at oder? sonst drehen die gedanken und menschen durch im kreise, immer wieder, lalala... bussibaba, deine zuckerlkettenfrau 💜 • #klubkulturretten#kunstkulturschätzen#freiheitleben#draussentanzen#kulturbrauchtfreiräume#sitzenmachtkrank#bewegungbringtfreude#cleanraving#sauberbleiben#soberrave#muellmitnehmen#werfeiernkannkannauchaufräumen #anticoronavirusvirenclub - @die_zuckerlkettenfrau on Instagram

Do you want the good news, or the better news? 👀 Well, the good news is Reggie is officially BACK - and heading off on the 19th September, for his first outing in 6 months 😍 Oh, and I almost forgot...the better news - it’s to compete in this years’ British Street Food Awards as sponsored by @hellmannsuk 👅 Utter Waffle 🧇 has made it through to the Southern Heats, for a second year running!!! Need reminding how we did at the finals last year? Swipe to jog your memory...🙄 Here’s to hoping we can recreate the result 😘 Thank you @britishstreetfoodawards - @utterwaffle on Instagram

one-ninety-five - @a.mac.n.cheese on Instagram

Many times their home has become my own- when I first arrived in 2018, when I fell sick with malaria, and when I had packed up everything to head back to the States for a season. They have been family for me, and it feels so good to visit a place so special with people I feel are my own. . For those of you who don’t know them, these are my Ugandan parents. #lifeinuganda - @kaleyg2 on Instagram

KVCCC member T R Raghunandan writes in, on his Sunday shenanigans So, after a hiatus of three years, I am back behind the wheel of the pink beast. As part of my pandemic plan, I drive two cars every weekend, usually to MG road and back. Today was the turn of Pinkamon. So, masked like an Elvis playing Zorro, I slipped behind the large wheel and luxuriated in the smell of rexine, so reminiscent of an old Ambassador. Well rexine and rats, actually. I made a mental note that the car needs to be given a thorough servicing soon. For far too long it had rendered service as a maternity home for stray cats, at my mum’s place. Of course, my son used to clear out the rat bones and take it for long drives occasionally, including one to Mysore with a couple of American friends stunned into speechlessness. It’s a wonder how one gets used to an old car so quickly. The large steering, with its low low ratio, posed no problems. So also the steering shift, which was as spongy as a warm custard. I smiled at the old Amby quirk; no matter what gear you are in, the gear lever is in the same place. Except that I tried to change to a non existent overdrive a few times, the Amby felt like I had driven it every day of the year. As I parked up in Church street, a group of models and photographers flocked around. Maskless, they choreographed and performed a dance in which old Pinkie played a central role. ‘Here boys and girls, you need to pay me for using my car,’ I said, They smiled at the old man in return. When I came back from my walk, another batch of youngsters had taken over. I stood aside and smiled to myself. At least on a wet Sunday morning I had brought some cheer into peoples lives. ‘Are you solding it, Sir?’ Asked a young man. ‘No,’ I said. ‘I am holding it.’ #kvccc #oldcarsinfrontofoldbuildings #bangalore #hindustanambassador #autumnrusset #sundayshenanigans #drivetastefully #indianclassiccars - @kvccc.in on Instagram

#surfthroughlife #californication - @vintagecarslab on Instagram

- Happy Together

Boston, it is with great bummed-outness that we tell you what you already know. We have no idea when our @thesinclair show will be able to happen, therefore we will be refunding tickets. We will see you as soon as we’re able to, right back at one our most favorite venues in the country. We love you, and we miss you! - @ballroomthieves on Instagram

🧀 You’ve asked, and we love you all - so WE’RE DELIVERING! 🧀 This Easter weekend, we’re putting together some D-I-Y Lunch Bags for you to feast on some proper grilled cheese in the comfort of your own home. (If your own home is on the North Coast. Everyone else: back to your banana bread.) . . For £20, you’ll get 2 x (ungrilled) grilled cheese w/ pickles + 2 x homemade chocolate brownies + 2 x bonfire hot chocolate kits. Add-ons are possible too. We’ll provide some simple instructions and make sure everything is prepared as safely as can be; you provide the 🔥 and 🥛. . . Emma’s going to be delivering on FRIDAY 10th + SATURDAY 11th APRIL, depending on your postcode - you’ll see which areas are covered on our website order form: www.cheesemaegden.com (link in bio). Payment is all online via PayPal so you won’t have to interact with a human, beyond maybe a nice wave when your food parcel arrives. Get your orders in by 8pm on TUESDAY 7TH APRIL please and thank you, then keep your 👀 peeled for the yellow van! - @minimaegden on Instagram

Lovely day for a cold glass of kombucha at @victoriaparkmkt Come say hi! . . . . . . . . . . . . . . . . . . . . . . . #kombucha #summer #market #londonmarket #foodmarket #refillrevolution #londonfoodie #refillrevolution #fermentation #ferment #probiotic #kompassion #sustainable #veganlife #vegan #guthealth #healthy #drink #kombuchaLondon #Londonkombucha #london #nature #local #seasonal #foodie #instafood #lono #boochnotbooze #nonalcoholic #alcoholfree - @kompassionkombucha on Instagram

لا اله الا الله .. انا لله وانا اليه راجعون .. ربنا يرحمك ويصبرنا علي فراقك يا جوجا يا جميلة يا طيبة يا كريمة يا راقية يا حنينة ياللي علمتيني معاني كتيير حلوه .. هتوحشينا اوي اوي 🙏🙏🙏 - @adawoodofficial on Instagram

The programme is OUT ! 👊🏽 Between Heaven and Earth by Najwa Najjar بين الجنة والأرض لنجوى نجار OPENING FILM Boston #Palestine #filmfestival Oct.16, 2020 #bpff @newenglandfilm #betweenheavenandearthmovie - @najwanajjarofficial on Instagram

Check out this awesome article on the problems we face with outdoor dining as restaurants! The insight you guys don’t really know. Chris, thank you so much for including us in there!🙏❤️ https://www.grubstreet.com/amp/2020/07/nyc-outdoor-dining-weather-storms.html #grubstreet#reopening#outdoordining#nycrestaurants#flushingfood#flushingfoodie#nyceats#nyceeeeeats#nycfood#nycfoodblogger#nycfoodgals#nycfoodies#nycfat#readallaboutit#hongkongfood#noodleshops#newyorkfoodie#newyorkfood#foodstories#newyorkcitylife#foodstagram#nycfat#nycfoodinsta#nycfoodchaser#nycfoodguide#hongkongfoodie#checkitout#shareyourstory - @maxisnoodle on Instagram

we take one picture together a year... congrats @walker_mcm & @laurenohlson, i dont think a more perfect couple exists - @alexanne_mackenzie on Instagram

The God Damn Wedding Continued. Thank you Laura and Sam for bringing everyone together. Thank you Tom for keeping your Juul charged up for everyone. Thank you Claire for helping find a tie and pocket square without me having a mental break down. Thank you white dove that hung out behind the altar the whole time. Thank you fireworks. (Yea there were fuckin fireworks) - @spooky_toot on Instagram

Missing the hand-made Tamales in Cusco. Have you been to a place where you discovered a food you loved to eat every day? Near the plaza de armas is a woman who sells her homemade tamales on the street. Looking forward to eating them again soon! Do you have a favorite food where you travel? - @adiosbasecamp on Instagram

Great to have @keirstarmer pay the @camdenhighline pocket park a visit this week!🌿🌸 Exciting plans underway for the Highline that we cannot wait to get started with ✨ Watch this space for updates coming soon 👀 - @camdentown_unlimited on Instagram

Namanya juga hidup.. kadang ketawa.. kadang ketawa banget 😂😂😂 . Gasskaaan ke Omah Cantrik @omahcantrik Kulon Progo 📆 Senin-Jumat ⏲️ 10.00 WIB - 23.00 WIB dan 📆 Sabtu-Minggu ⏲️ 08.00 WIB - 23.00 WIB menyediakan @cantrik.vwgarage Wisata Fun Trip VW Safari Susur Desa Foto di keindahan panorama Kulon Progo Berkunjung ke Pengrajin pandan dan bambu CP 081227510573 . . . #vw #vwsafari #vwlove #garage #classic #car #cars #otomotif #community #kulonprogo #yogyakarta #jogja #wisatajogja #vintagecar #vintagestyle #photography #foryou - @cantrik.vwgarage on Instagram

Surfs up with the Buttercup - @pirate_scar on Instagram

Η νέα σεζόν προστάζει μίνιμαλ αισθητική με artistic πινελιές που κάνουν την εικόνα των νυχιών εκλεπτυσμένη και ταυτόχρονα μοντέρνα. Δεν θα μπορούσα λοιπόν παρά να εμπιστευτώ την καλύτερη για το μανικιούρ μου, την Ραφαέλα Ψαρρού ή αλλιώς τη σύζυγο του Γιώργου Καράβα (ναι, ναι σωστά διάβασες, αναφέρομαι στον νέο coach του #gntm)! ✌️ Έκλεισα το ραντεβού μου στο χώρο της @youvegotnailsbyraf και περάσαμε ένα απόγευμα που ήταν καθαρά γυναικεία υπόθεση, με όμορφα μυστικά που σίγουρα θέλεις να μάθεις. Δες ολόκληρο το ρεπορτάζ στο #linkinbio και στο #marieclairegr Φωτογράφος @faith_for_william @rafaela_psarrou @yiorgoskaravas_official #nailsofinstagram #nailtrends2020 #manicure #minimalnails #beautyeditor #influencers #l4l #journalist #ilovemyjob #followback #interview #giorgoskaravas #yiorgoskaravas #rafaelapsarrou #beautyinspiration #beautytips #nails #beautysecrets #beautyjunkies #girls #gntmgr - @the_spaghetti_hair on Instagram

- @c_a_r_ssss on Instagram

Bursdagsfest for Marianchen 🥳 - @jcvestre on Instagram

12/09/20 💕 - @motherofcars on Instagram

𝑾𝒉𝒆𝒏 𝑯𝒆𝒏𝒓𝒊 𝑽𝑰𝑰𝑰 𝒎𝒆𝒆𝒕𝒔 𝑱𝒂𝒎𝒆𝒔 𝑩𝒐𝒏𝒅 As an art historian, I like to explore beauty and history beyond my field of speciality. This magnificent sequence of classic Aston Martin DB5, with the Tudors residence of Hampton Court Palace as a background was a beautiful sight for the eyes, but also a breath full of history. #concoursofelegance #astonmartindb5 #jamesbondscar #tudorhistory #classiccars #specialevents #englishstyle #perfectlines #beautyandhistory - @valebrucco on Instagram

Heading into the weekend with plans to work, work, and oh yeah work! Maybe I’ll throw in a break or two to get some fresh air but so much editing, so little time! 📸 . . . . . . . . . . #cuba #photographer #travelcuba #cubatravel #covid19 #lifestyle #quarentine #covid #journalism #photography #streetphotography #planschange #vintagecars #photos #cubastyle #photojournalism #photojournalist #travel #colortheworld #cubacars #cubaphoto #lifestylephotography #throwback #tgif #cuban #freelance #friday #Nikon #portraitphotography #car - @vpg_photography on Instagram

I remember when I used to DJ on Saturday nights 😂😂 - @tiptoesmusic on Instagram

📷 - @thegirlwiththeoldcar ____________________ #morrisminor #morris1000 #minor1000 #classic #classiccar  #retro #retrocar #vintage #vintagecar #antique #antiquecar #car #mmoc #mmocym #ohsoretro #1960s #1970s ____________________ Tag @mmocym or #mmocym for a feature - @mmocym on Instagram

- @brum_depoca on Instagram

What does a wedding company do when they have no weddings?⚡️ We LOVE what we do and our purpose in life is to create luxury gatherings and ‘give our clients amazing memories to last a lifetime’ What happens when you can’t fulfil both your personal & company vision? In numbers, we’re the UK’s largest tipi & Sperry tent company delivering 370 events in 2019, across bases in Oxfordshire, Yorkshire & Perth. This year we’ll complete around 30 events, less than in our first year of business 14 years ago. Our amazing team have been with us every step of the way. Admittedly we’re smaller (which is heart breaking), but the support we’ve felt from Team Papa will stay with us forever. You’ll have met or spoken with many of us over the years and they’re the bedrock of what makes us so very special. We’re grateful to each and every one of them for their resilience and understanding. What have we been doing and what will our future look like? 👰🏻 We’ve been lucky enough to do some, smaller and more ‘intimate’ weddings with up to 30 guests. The feedback has been wonderful and what a year to have on your marriage certificate! 🎪 We’ve provided structures for Hotels, Universities & City Centres giving them extra space for social distancing. 👨🏾‍💻We’ve been busy producing quotations and taking bookings for next year, 2022 & beyond. We’re still getting plenty of enquiries from brides and grooms excited to be booking their big day and looking forward to the future. 🍹 We’ve run THORS tipi SOL AST, a successful and busy ‘Covid-Secure’ Summer pop-up bar in York. We’ve loved creating a great atmosphere, a unique experience and brilliant customer service! And plans are still on for our Winter bars. Weddings are still our core, what we love being a part of, and we have lots booked for next year. The future looks more enticing than ever. After a year in which we’ve been denied the chance to dance, to dine & party the night away, we know every future party will be incredible! Much Papa love, Amanda and Rich xx - @papakata on Instagram

Week-end 🌊 @happyhealthyila - @mariadelaord on Instagram

🇯🇲Our goal is simple: Connect people by making the food we love❤️ Thank you @tripadvisor and our amazing customers! 🙏🏽 - @jerkgrill on Instagram

👫 - @sofiebiss on Instagram

- This brought great joy to my inner 9-year old

Am Samstag waren wir im Einsatz für die 900-Jahr-Feier der Stadt Freiburg. Unter dem Motto „gemeinsam weiter“ machen auch wir weiter mit unserem Projekt FREIBURG DANCE WEEK und planen für den 12. bis 16. Mai 2021 viele tänzerische Highlights :) Danke an Judith, Jasmin, Sina und Rudi für die unermüdliche gute Laune trotz suboptimalem Wetter ;) www.freiburg-danceweek.com - @tanzschulegutmann on Instagram

If you not loyal to yourself, You can’t be loyal to people around you!! Models/stylist @glitter_trotter @allen_the_dapper Dressed by @fala_wear Photographer @__calebokumu - @allen_the_dapper on Instagram

Actuellement en Road Trip dans les Asturies avec @elsagelhard pour @stradivarius . Que demander de plus? Passage obligatoire au Musée Jurasique après avoir vu la mer et la forêt #stradivarius #asturias - @amandine.pouilly on Instagram

My ride for the next few days . #vespa#sicily🇮🇹 #Marsala - @afshindjoon on Instagram

Some people say fast-food chains are only putting #alternativeproteins on the menu because they see dollar signs 🤑⁣ ⁣ “Um, duh. ⁣ ⁣ GFI executive director Bruce Friedrich penned an op-ed for @guardian to explain why we should applaud these big moves, no matter the motivation. Read the full piece at the link in our bio! - @thegoodfoodinstitute on Instagram

Those days when mum and dad made me share my birthday with you cause mine was just two days after yours..... 😜....we both didnt like that idea back then.... But I wish they were here to do this for us.... I love you bruv.... In spite of all the fights😝😏 ..... God bless you..... 😘😊💞.....@godswaykuwornu - @retired_leftie on Instagram

Blogged by @ndigerald. The Afronomads started off showcasing their travels in Zimbabwe and other African countries through content visuals on Youtube which consist of the content creation side of their entity. Through their content creation an opportunity arose to create a travel agency to service an audience which was influenced by their travels. “So many people were asking us how we travel and asking us to help them; we saw that as a business opportunity and also help people because already on our social media platforms we were giving out information so the agency handles from as little as an itinerary or help you plan your whole trip.” They reiterated that their intention is to inspire young Africans to travel and capture a community of young travellers who want to travel locally which will in turn give a purposeful contribution to the domestic tourism in Zimbabwe. @afronomadszim. @chii_muty @tariro_muty . . . #Travel #Africa #Invest #People #SeeAfrica ##Nomads #Travelling #Checkoutafrica - @checkoutafrica_ on Instagram

Summer vibes ☀️😎☕️ #throwback to last years release party of @unikat_magazin 😎💥 Serving the best coffee with our ECM Ape #piaggioape #ecmespresso #weliveespresso #ecm . . . . . . #espresso #coffee #crema #cafe #coffeetime #coffeegram #coffeeaddict #barista #coffeeholic #coffeeshop #latte #coffeeart #specialtycoffee #caffeine #thirdwavecoffee #instacoffee #coffeeroaster #coffeeoftheday #baristadaily #thetrendybarista #coffeecommunity #coffeeculture #flatwhite #espressoape #heidelberg - @ecmespresso on Instagram

Ready for some new projects and intercultural exchanges⁉️⁉️⁉️ 🇹🇬X 🇩🇪 Haber member @monafrvr and Sani Banacéma the Director of our new Partnerorganisation ASEVEC @freundetogos in the planning...... ‼️SO STAY TUNED ‼️💯 - @haber_project on Instagram

During @nyfw . . #fashion #fashionista #fashionstyle #dailystyle #design #minimalstyle #womanstyle #trend #summerstyle #stayhome #fashionweek #prada #womanfashion #style #influencer #styleblogger #milan #nyfw #hermes #fall #italy #casual #2020 #paris #parisfashionweek #easystyle #model #streetstyle #instafashion 👁‍🗨#daily_style_fashion_ - @daily_style_fashion_ on Instagram

Passage aux sympathiques viviers de Beg ar Vill, où de nombreux produits de qualité de la mer vous attendent !! Avec la qualité daccueil et de service au top !!!😊😊🤗🤗😍😍 On y retournera avec notre club véhicules anciens Gouesnou prochainement 😉 - @vehiculesanciensgouesnou on Instagram

@rob.bell is volunteering for @transportingc driving care workers safely to and from their place of work, helping them avoid using public transport and therefore helping to stop the spread of Covid19 in care homes. Amazing work! . . . . . . . #VolunteersAgainstCovid19 #volunteers #carehometransport - @arlingtontalent on Instagram

“Bringing oral care into wellness — they’re doing it while keeping it accessible and making an impact.” A huge thank you to @alwayskarin and @forbes for sharing our story, our evolution, and our vision for a healthier future. Grateful for your words, and proud to share this piece! Full link in bio ❤️ - @levicii on Instagram

@ferdinand.gastropub always leading ! - @ferdinand.gastropub on Instagram