Sharp Teeth Profile Pics

teethscarysharpsmileanimeangrycreepysharkfangs
smile happy eager zealous enthusiastic

wax - @vongrow1 on Instagram

hanns scheewe hanns mouth hanns scheewe roar

- Gold Braces

gakgak gak patrickppz gakster blm

Não existe estética rosa sem estética branca e estética branca sem estética rosa. Pra que isso aconteça é fundamental trabalhar em equipe e que esta equipe esteja afinada. Me sinto um privilegiado profissionalmente em ter grandes amigos e poder trabalhar com grandes profissionais. Obrigado meu amigo @williamfrossard pela amizade e oportunidade. Parabéns pelo trabalho excepcional. Ficou maravilhoso . Dá gosto de ver. #periodontiaestetica #periodontologia #recobrimentoradicular #enxertodetecidoconjuntivo #injertodetejidoblando #injertodetejidoconectivo #periodoncia #recubrimientoradicular #recobrimentoradicular - @sergiokahn on Instagram

zoom in adorable cute cat fangs sharp teeth

- Day 4. Pain is manageable. Swelling is almost all gone.

arab skel skull smile star rank

- Female Lips

angry its rucka toto africa parody song i have sharp teeth grrr

ART 🖌 #ceramics - @ceramicsbyreinaldo on Instagram

heintje de_malt_blumen de malt blumen bilg bling look

- My daughter lost her tooth today. It had a cavity all the way through.

angry its rucka toto africa parody song i have sharp teeth grrr

- Information

kroppa art drawing surrealism modernart

A beleza de imitar o natural... Essa é a minha filosofia, a minha busca constante da naturalidade!!! - @dr.jonasandrade on Instagram

teeth brushing teeth monster sharp teeth

- F/28/4’11” [125lbs 120lbs = 5lbs] 4 month progress with braces! I’m working on weight loss too, but I’m more excited to have a pretty smile soon!

timmy smile beard hand

El regulador de función de Aragao es un dispositivo con el que regulamos las funciones del nervio trigémino, con esto solucionamos muchísimos problemas de salud de los pacientes. Entra en el link de nuestra bio para más información - @ortholablaboratorio on Instagram

anime spiiky teeth book tongue talk

- My friends tongue, she doesnt like pineapple very much.

clapping amanda holden britains got talent good job applause

18k white gold hello kitty charm and 4 medium Swarovski Crystals for @juliamedeir0s 🐱❣️ Swipe to see the specials I’m offering till the 26th! Dm to book an appointment! 🦷 Prices are in my bio✨ Feel free to ask questions! •LA BASED •Application is painless and quick! (No drilling) •Book me for events! •House calls always available •Last 6+ months(some last up to 3 years!) •Two month guarantee included . . . . . . . . . . . . . . . . . . . . . . #toothgems #toothjewelry #tooth #Swarovski #teeth #toothgemtech #toothgemtechnician #toothjeweler #toothbling #dtla #toothgem #toothfairylife #losangeles #toothgemlosangeles #toothgemsla #toothjewels #18k #gold #whitegold #18kgold #goldcharms #toothgemz #toothkandy #toothcandy #labased #la #hollywoodtoothgems #toothgemshollywood #ktowntoothgems #toothgemsktown - @toothgemsbygrac13lla on Instagram

nilabas ang ngipin shyr jane balagtas jayro gatdula balagtas shyr balagtas gigil

🦷💫SWIPE TO SEE AN AMAZING BEFORE AND AFTER! 💫🦷 Our wonderful patient achieved the smile she’s always wanted with the help of Invisalign, composite bonding and Enlighten teeth whitening. Her main concerns were small lateral incisors and crowding, but she also wanted her teeth brightened up - we have to say what an amazing result!✨ Do you dream of beautiful teeth like this? Call us on 01580 848171 to book your consultation #invisalign #invisaligninkent #teethstraightening # compositeveneers #veneers #teethwhitening #dentistinkent #dentist #cosmeticdentist #itero - @staplehurstdental on Instagram

kstr kochstrasse agenturleben agencylife hannover

- Brackets

monster smile grin teeth blood

- Grill

sudo blep blep sudo

- Jewelry and Accessories

kamal haasan maya machindra maya machindhra indian hindustani

- Dental Technician

netmarble keke

- Lingual Braces

anime nanbaka smile sharp teeth

- Cursed_Fingers

neil breen neil breen neutral face

- Thanks, i hate teethnails

wolf scary teeth sharp

Are you using silicon keys for your Composite restorations 👇👇⠀ **⠀ Join the tribe 📸📸😎👍⠀ Link in 👉 BIO⠀ --------------------------⠀ 📖 Esthetic Dentistry @ijedentistry⠀ 👨🏻‍💻 Dental Literature @dentistnewsletter⠀ 🦷 Connecting @dentistryzone⠀ -------------------------------⠀ 📸 Author: @felipevillaverde.com.br⠀ ⠀ *⠀ Hashtags:⠀ #dentist #dentistry #smile #veneers #dentalphotography #dentalart #smilemakeover #smiletransformation #dentalworld #digitaldentistry⠀ #naturalsmile #composite #compositerestoration - @dentist.camera on Instagram

pokezz gory asagis orpios

- Affordable dentures

monty python terry gilliam teeth dancing teeth animation

💦 O hábito de sucção de chupeta pode promover força nos dentes e nas estruturas que os envolvem❣ *Não são em todos os casos que acontecem, ok ???? ⚠️ A deformidade será maior ou menor dependendo da frequência (quantas vezes e quanto tempo a criança suga por dia), intensidade (força usada para sugar) e duração do hábito (quantos meses ou anos de sucção)❣ Com isso, podem ser observadas alterações na conformação das arcadas (mordida aberta e/ou mordida cruzada ), alterações funcionais (respiração, fala, sucção e deglutição) e alterações da musculatura orofacial❣ 👶🏻 A Associação Brasileira de Odontopediatria e o Ministério da Saúde recomendam que a idade de 3 anos seja a época limite para a eliminação do uso de chupeta na vida da criança❣ 🦷 Entretanto, reconhecem que o ideal seria remover gradualmente e gentilmente este hábito até a idade de 2 anos, pois existe a chance de auto-correção de possíveis desarmonias nas arcadas dentárias, em consequência do mesmo❣ 🥰 Essa remoção deve ser adequada ao amadurecimento emocional respeitando estes limites da criança❣ E aí? Seu filho usa a chupeta? 👉🏻 Consulte sempre seu Odontopediatra!! . . ✍🏻Texto @dentista.kids 📸 Foto: @dra.simonedifiore . . . . . . . . . #odonto #odontogirl #odontologia #insta #casoclinico #amoodonto #odontoporamor #dentista #dente #tooth #art #arte #resina #sorriso #odontology #smile #teeth #dentist #dentistry #odontolove #odontolovers #kids #criancas #odontopediatria - @odontogossip on Instagram

heh shrug smile nervous ned

- I think this is brilliant. But awful.

meme triggered funny angry sharp teeth

Odontologia digital na rotina do Consultório. #nhuchodontologia #fotografiaodontologica #dentistaportoalegre #odontologiadigital - @julionhuch on Instagram

smiling tori kelly 25th song happy glad

Motivational Mockup #3shape #laboratoriodental #protesisdental #dentaltechnician #dentaltech #smilemakeover #digitaldentistry #digitalsmiledesign #smiledesign #dentallab #dentalart #waxup #digitalsmiledesigner #veeners #digitaldentistry #cadcam #smiledesigner #cadcamdentistry #ivoclarvivadent #dentallaboratory #encerado #digitaldesig #dentistryworld #exocad #odontologia #odonto #dentalcases #bestsmile #bestsmiles #ivoclardigital - @javi_p4ris on Instagram

teeth scary eat

- Gold Teeth

bg prod wow bg products bg before bg works

La meilleure combinaison pour vos restaurations! #akroflex de #hufriedy et la digue de #crosstex 😍 📸 : @drlouistoussaint 🙏🙏 #hufriedygroup #hufriedyinstruments #dentaldam #dentaldams #diguedentaire #dentalrestoration #dentalphotography #dentalphoto #dentalesthetics #dentalesthetic - @hu_friedy_france on Instagram

ban anime scary fang sharp

Rose gold livin 🌹 #explorepage #explore #bespoke #bespokejewelry #gd_jeweller #grillz #silvergrillz #goldtooth #gold #goldslugs #jewelry #jewelrydesigner #fashion #hattongarden #london #reading #swindon #bath #bristol #oxford #customgrillz #9ctwhitegold #whitegold #gold #asaprocky #nines #9ctgold #9ct #18ct #18ctwhitegold #18ctgold - @gd_jeweller on Instagram

smiling tori kelly 25th song happy glad

- ready for French kiss

pokemon squirtle laugh

Paciente que acude a consulta con una ortodoncia previa y que refiere tener un canino retenido que no han podido llevar a posición. Decidimos iniciar nuevamente el caso evitando colocar brackets en los dientes vecinos al canino retenido por estar muy cerca de las raíces de esos dientes. Al diente retenido lo descubrimos nuevamente para luxarlo y así facilitar su movimiento para poder llevarlo a posición. Una vez traccionado el canino, aplicamos una mecánica de cupla para desrotarlo y poder llevarlo a su posición dentro de la arcada. Un tratamiento complejo pero que nos trae mucha satisfacción ver los grandes avances que hemos conseguido. #hoffmanortodoncia #ortodonciavenezuela #ortodonciacaracas #ortodoncistasvo #orthodontics #ortodoncia #ortodontia #clinicaodontologicanouhadsayegh #dentistry #brackets #braces #odontologia #caninosretenidos - @dr.hoffman_ortodoncia on Instagram

implantatzentrumherne implantatzentrum herne helka dochelka

- Dr. Wong Social Media Mood Board

smiling scary face creepy face creepy smile scary smile

Busy day..Lecture @PAOT Nijmegen...Next: Success Simplified workshops! @cesabrosa @patel_akit @paulomonteiro_md @stefanvweg @licasabrosa @karen.geber @moniquemcastro . . . #cesabrosa #ces #dentall #difuse #customizedestheticdentistry #aestheticdentistry #estheticdentistry #digitaldentistry #cadcamdentistry #cadcam #implantdentistry #dentalimplants #prostheticdentistry #prosthodontics #multidisciplinarydentistry #ghentuniversity #heineoptotechnik #effdental #poclusal #cerec #ominicam #3m #successsimplifiedconcept - @stefanvweg on Instagram

kstr kochstrasse agencylife lips smile

- MUSE WIDGETS

teeth lexis bouchard evil hows my smile self conscious

#e.max_ceram_zirconia - @daiyuwakita on Instagram

captain grime grime amphibia

- 31

vampire creepy sharp teeth smile

Временные коронки на имплантатах и боковых зубах, временные адгезивные прототипы на передних зубах. Temporary crowns on implants and back teeth, adhesive prototypes on front teeth. @dazhaevclinic #гаджидажаевкурсы - @dr.dazhaevgadzhy on Instagram

smilesecret smile secret star stern

@ja.solares amiga, tá na jesuíno com a frederico, acho que cabe. corre lá antes que alguém pegue. #CECÍLIASEBUARQUES - @corralorrancorra on Instagram

tama and friends dentist appointment teeth showing teeth cats

- Horse mouth (by Ilya Rogov)

smilesecret smile secret star stern

Full Mouth Rehab 🔸Anterior ceramic crowns 🔹Posterior direct composites 🔸Key to success = planning and canine guidance A challenging but rewarding case. Thanks to @alan_precisiondental for all his work on this case. #dentistry #dentist #dental #smile #teeth #cosmeticdentist #tooth #dentalphotography #veneers #invisalign #dentalcare #teethwhitening #oralhealth #dentistrylife #smilemakeover #dentistryworld #composite #restorative #instadentist #beauty #dentistlife #prosthodontics #rubberdamfam #ceramics #emax #indextechnique #crowns #bridges #cosmetic #toothwear - @shanklasmiles on Instagram

vampire creepy sharp teeth hello

“Post Mortem Pink Teeth Phenomenon” The appearance of pink teeth after death is a common phenomenon in forensic dentistry. “the pink teeth phenomenon is a common finding related to cases of asphyxia such as strangulation, drowning or suffocation. Here is the article — http://www.medicinaoral.com/pubmed/medoralv14_i7_p337.pdf . . . #forensic #medicine #forensicscience #information #forensics #science #info #forense #medical #forensicinvestigator #lab #toxicology #forensicpathology #hindi #last #second #affairs #teamtathya #current #gk #hindigk #rochaktathya #hindiquotes #tathy #bhopal #original #day #fact #facts #bhfyp - @forensicscience_ on Instagram

smilesecret smile secret star stern

- Adenoids

teeth dabble sugar sharp

В ФИЛИАЛЕ МОСКВЫ И САНКТ-ПЕТЕРБУРГА ОТКРЫТА ЗАПИСЬ К ОРТОДОНТУ! ⠀ 📸 На фото представлена брекет-система ⁩ Innovation-R (GAC, Япония) ♦️Стоимость: 32.000 руб/ 1 челюсть ⠀ Рекомендуется установить брекеты в следующих случаях: ⠀ ✔️аномалии отдельных единиц или зубного ряда в период; ✔️формирования прикуса или после его завершения; ✔️перед протезированием (в зависимости от конкретного случая); ✔️при корпусном перемещении зубов; ✔️при необходимости коррекции профиля лица. ⠀ ⚡️Брекет система подбирается индивидуально с врачом на консультации ➖➖➖ 📥Запись по телефону: +7 (812) 600-20-70 🖊Direct ➖➖➖ Наши клиники: 📍Мск: ул. Спартаковская, 24. (Метро Бауманская) 📍КРД: ул. Московская, дом 61. 📍СПБ: Невский пр-т, ул. Думская 4 - @anatomia_beauty_clinic on Instagram

smile smiles hess ortho hessorthodontics orthodontics

Deep Marginal Elevation and Emax Crownlay to finish the week. Happy Friday everyone. #keepcerecing #emax #emaxcrowns #deepmarginelevation #rubberdam #rubberdamology #cerec #samedaydentistry #ivoclarvivadent #ivoclar - @keep_cerecing on Instagram

vampire vampire teeth open mouth sharp teeth rawr

_As guias,sejam elas digitais ou analógica minimiza as chances de falhas. —E com protocolo correto,teremos uma previsibilidade das restaurações..... .—para conhecer nossos trabalhos sigam@dkesthetidigital... . . #planejamentoesteticodigital #reabilitacaooral #reabilitacaoestetica #job#facetasdeporcelana #lentesdecontatodental #digital #digitaltech #odontologiafigital # - @dkestheticdigital on Instagram

smilesecret smile secret teeth z%C3%A4hne

- braces

sharp teeth

Керамические реставрации - Виниры изготовлены нашей лабораторией. Производим несъёмные безметалловые реставрации любой сложности✅ Имеем свой cadcam центр. 👌🏽 Работаем с клиниками и лабораториями. 🏥 По вопросам сотрудничества и консультаций в Директ, а также на телефон или электронную почту☎️📲💻📧 #цифроваялаборатория #cadcam #veneers #veneer #crown #виниры #коронки #имплантат #зуботехническаялаборатория #зубнойтехник #зубнойтехникказань #exocad #стоматолог #стоматология #стоматологияказань #красиваяулыбка #люминиры #винирыказань #comptondentallab #kazan #dentist #dentalart #emaxpress - @compton_east_cadcam on Instagram

smilesecret smile secret teeth z%C3%A4hne

- MUSE WIDGETS

scary what sharp teeth harmless smile

@davide_damiola #damonsystem #damonsystembraces #ormco #orthodontic - @damon.club on Instagram

bruno approved thumbs up okay ok

- You can see which teeth of mine were filled underneath blacklight.

bohl teeth yum creepy face

- cosmetic dentistry

garden tuin tuinieren lifeandgarden blijmaker

- Braces

bite much anime masakaki ccontrol

@d_aligners_ + @flowjacsystem . Sistemas mínimamente invasivos. Tratamiento híbrido con las mejores cualidades de cada sistema. El tratamiento finalizará con alineadores superiores e inferiores. . . #alineadores #aligners #dentistica #orthodontic #minitubs #ortodoncia #invisaling - @andmeloand on Instagram

dentures teeth gaul jadul smiling gigi lu gondrong

- Getting Braces ?

glowing teeth sharp teeth scary open mouth

- @theco_dent_ist on Instagram

brawlhalla

Y qué tal si te pones los colores de tu equipo favorito? ⚽️ ⚽️⚽️ Sabias que puedes escoger los colores de tu ortodoncia y combinarlos a tu gusto?? Usamos lastíes de la mejor calidad, No se manchan no se decoloran mantienen su rango elástico para que tu ortodoncia sea eficiente. www.dentalvipservice.com . . #americanorthodontics #ortodonciacolombia #ortodonciaestetica #ortodonciaparaniños #odontologiaespecializada #minimasterbraces #bracketsmetalicos . - @dentalvipserv on Instagram

teeth hiss girl anna kendrick bare teeth

- A childs skull before losing baby teeth

como camina foxy fnaf five nights at freddys eye patch

- hmmm

zero two fang anime fangs sharp tooth

- Dental Bridge Before and After

netmarble keke

Coronally advanced flap with connective tissue graft. . . . . #connectivetissue #connectivetissuegraft #coronallyadvancedflap #zuchellitechnique #gingivalrecession #gingivalrecessionstreatment #gumdisease #periodontolgy #periodontia #periodontoloji #pinkesthetic - @dr.scelen on Instagram

shark

From our FB group Zerodonto Dentistry⁣ Time to join! 🤓⁣ ⁣ ⁣ #zerodontodentistry #zerodonto #dentistry #smile #dentist #esthetics #tooth #dental #teeth #prosthodontics #orthodontics #endodontics #periodontology #invisibleorthodontics #estheticdentistry #dentalcare #odonto #dentalstudent #odontolove #odontogram #odontologia #oralhealth #happyteeth #healthyteeth #dentalphotography #smiledesign - @zerodonto on Instagram

skater dinos big eyes sharp teeth sneakers skateboard

- Beauty Tips & Tricks

urusei yatsura lum space invader

Aviso urgente: Mi proceso de autodestrucción ha comenzando. No sé cuándo llegará a su clímax pero pido se encierren y esperen el cataclismo. No dejen a las mascotas afuera, probablemente tendrán que comerlas para sobrevivir. Hasta nunca. - @chefherrera on Instagram

bulldog rip open fierce sharp teeth im here

Will it last? Fracture re-bond #aesthetic #aestheticdentistry #rubberdam #rubberdamology #adhesivedentistry #dentista #dentistry #restorative #restorativedentistry #odonto #odontologia #dentalcare #dentalworld #dentalphotography #dentalphoto #stomgo #teeth #styleitaliano #dentalart #dental #diente #dentaltechnician #tooth #zerodonto #identistry #teeth #anterior #composite #molar #toothpreparation#bdibypadros - @robertopadros on Instagram

finding nemo bite piranha sharp teeth

@davidavalonofficial - @davidofkorea on Instagram

smilesecret smile secret star stern

made this as a reminder to myself but figured my anxious friends here also could use the reminder - @hexelot on Instagram

dolittle tiger animal snarl snarling

- Oral Care

concern shark

~Ritrattare o non ritrattare questo è il problema 🤔~ Let’s keep to follow up #styleitalianodentistry #rubberdamology #rubberdam #digitalworkflow #analogicalworkflow #zirconia #disilicato #intarsio #corona #italiandentistry #lovemyjob ❤️🇮🇹💪🙏 - @dott.filippo_menini on Instagram

shark nat geo sharp teeth razor sharp scary

- Almonds

skater dinos big eyes green cap sneakers

last night i was woken out of sleep by the reality that some day i’ll die... literally forgot all about that death shit. i preface with this because today is my father’s earthstrong...and while our relationship is not perfect i’m very fortunate to have the man in my life and some of the keys he’s given me. life is like a McRib... here for a limited time only -sometimes that bitch might be a rat sandwich but for the most part it can be quite delicious if you care to indulge. Happy Earthstrong to my father, Lawrence. - @black_zuckerberg on Instagram

shark fantastic chomp sharp teeth

- This denture lighter

smiling tori kelly 25th song happy glad

🙌 „Exzellente dentale Ästhetik“: in dieser Rubrik unserer „QZ – Quintessenz Zahntechnik“ zeigen wir Ihnen in jeder Ausgabe einen besonderen Fall. . Was Sie in der September-Ausgabe sehen: 👉 Ausgangssituation: Alte Brücke OK-Front, vertikaler Gewebeverlust an Zahn 11, Kieferkammresorption im Bereich 12 – Patient wünschte stabile, harmonische Verbesserung der Gesamtsituation. . 💡 Lösung: Zwei Cercon-Brücken für die Front und eine Presskeramikkrone aus Celtra für Zahn 24 (beides Dentsply Sirona), verblendet mit Celtra Ceram, zuvor Gingivaplastik an Zahn 11 und therapeutische Versorgung. Ausgeführt von ZTM Hans-Jürgen Joit und Behandlerin Dr. Alexa von Gienanth, Düsseldorf. . Zur QZ hier entlang ➡️ www.quintessenz.de/QZ . Für Abonnenten ist die Online-Version kostenlos verfügbar. ✅ Jetzt abonnieren oder kostenloses Probeheft anfordern! . . #QuintessenzZahntechnik #exzellentedentaleästhetik #Zahntechnik #Dentallabor #QuintessenzVerlag #QuintessencePublishing #ZeitschriftfürZahntechnik #ZeitschriftfürZahnmedizin #dentalesthetics #dentaltechnology #dentallab #dentallaboratory #dentalwork #emaxceram @dentsplysirona.de - @quintessence_publishing_de on Instagram

pennywise clown sharpteeth scary creepy

- Types of Braces

hide my teeth maddie back to the outback sharp teeth shy

- Bad teeth, we can fix them, have a smile that lasts a lifetime.

shark nemo finding nemo smile creepy

- Got a dental floss stuck on my braces. (I only have braces back there rn to close a gap.)

skater dinos big eyes green cap sneakers

- Smile teeth

sabretooth marvel hungry lick lick teeth

- These Patient Dental Moulds found in the basement of an abandoned psychiatric hospital (More in comments)

smiling hubert billy west futurama big smile

- Iced out grillz

meme triggered funny angry sharp teeth

- AACD Member Benefits

yes plants vs zombies chomper uplou monster

- @dentalphotography.club on Instagram

saki sukinasaki saki sukinasaki sukinasaki saki medaka

@dentist_lovers_world - @dr.ramejkov on Instagram

vibrating shaking portrait head face

- Dr Eduardo

venom scary teeth sharp tongue

- Braces colors

eddsworld tord red jacket sharp teeth sad

Welcome to my new page! Where I will be sharing some oral hygiene/health tips and advice 🦷 Oral Health promotion workshops to come in the future 🧚🏻 . . . . . #theoralhygienehub #oralhealth #oralhealthpromotion #dentistry #dentalhealth #dentalstudent #dentalhygiene #dentalnurse #healthylifestyle - @theoralhygienehub on Instagram

hello shark great big shark nemo marlin

- Braces

skater dinos big eyes blue hat sharp teeth sneakers

- A-List

smiling hubert billy west futurama big smile

Excelente progreso de caso con mordida abierta anterior y cruzada posterior. Nuestro primer enfoque fue atacar el problema transversal realizando una secuencia de arcos, seguidamente se trató el problema sagital (antero posterior) mediante elásticos intermaxilares y extracciones de premolares inferiores, para finalmente, lograr cerrar la mordida a través de interferencias linguales y elásticos en caja (zona anterior). Siendo éste un caso donde la base del problema era esqueletal, propusimos cirugía, pero por razones personales, el paciente no aceptó, por lo cual procedimos, previa autorización del paciente, a tratar de camuflajear el problema y hasta este punto vamos bien. Aún falta camino pero vamos logrando los objetivos trazados. Feliz día! #SonrisaCOR #TratamientoDeOrtodoncia #SaludBucal #Casos#Brackets #Ortodoncia #COR #COROrtodoncia #ventanaquirurgica #HermanosRodriguez #CentroDeOrtodonciaRodriguez - @rodriguezortodoncia on Instagram

kstr kochstrasse words mouth speech

Someone’s starting their weekend on a high note! 🎶 - @dr.neymarksmiles on Instagram

sharp teeth national geographic open wide cookiecutter shark teeth

- Conversional Pieces

smiling wide smile white teeth teeth

Si quieres saber más del concepto de tratamiento All-on-4, aprovecha la próxima mentoría con la Dra. Fojo en su clínica. Asiste a una cirugía en directo desde la colocación de los implantes hasta la confección del a prótesis. No te lo pierdas: nobelbiocare.com/formacion #nobelbiocare #formacion #implantesdentales - @nobelbiocarespain on Instagram

jurassic world fallen kingdom indoraptor dinosaur dinosaurs

Beautiful natural looking hand sculpted porcelain veneers. These are custom made to fit your face and enhance your smile! ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ Porcelain veneers are customized to each patient and are hand-made with meticulous craftsmanship. Porcelain veneers, done correctly, make your smile look stunning. - @drmikewei on Instagram

fangs eating sharp teeth contemporary art graphic design

- Alzheimers & Dementia

happy halloween scary sharp teeth

Con nuestro filtro polarizado es más fácil conocer el estado de salud del diente, permitiendo un análisis más riguroso y un diagnóstico eficaz. ▶️ www.filtropolaris.com #dentist #dentimpact #plannig #planification #dentalphotography #fotografiadental #canon #nikon #dentist #dentistica #dentistry #odontologia #estetica - @filtropolaris on Instagram

chasing curiosamente dragon run away escape

- Gold Braces

pokemon cute adorable squirtle sharp teeth

- Cute braces colors

the loveable zoo cat fat scary sharp teeth

Duran Nunes de Pinho Veloso CROMG 40750 Especialista em Ortodontia . - Tratamento em andamento. . . . Essas imagens são meramente ilustrativas, pois os resultados podem variar conforme o caso clínico. . . . A utilização destas imagens ficam restritas a autorização expressa, sendo vedada a reprodução de terceiros. - @orthodonticmoc on Instagram

heeeeeee mad dog sharp teeth

- Dental aesthetics

doubledougs dougs trex dino dinosaur

#repost @drsergiodacunharibeiro #liraodonto #liraodontokids #odontopediatria #belavista #altodepinheiros - É assim que enxergamos “uma boca” (Sistema Estomatognático) com sua grandeza e importância na saúde global de nossos pacientes. #odontologia #dentistaaltodepinheiros #dentallovers #liraodonto #liraodontoap - @liraodonto on Instagram

jody high roller braces silver sharp shark teeth

- Braces Rubber Bands

. . . . #identistry #dentistry #dentistsofinstagram #dentist #dentistrystudent #dentalhygienist #dentalclinica #dentalhumor #openbite #abnormaleruption #protusion #underbite #deepbite #crossbite #crowding #oralpathology #teeth #permanenttooth #tooth #toothgems #implantology #crowding #dentallife #dentistgram #dds #dentalworld #followforfollowback #followers - @den_tistree on Instagram

- I must have snored a lot last night, my uvula has swollen enough to sit on my tongue

- Braces colors

- Braces smile

So happy for Friday🥳 its a working weekend with Implant training but atleast its still the weekend. 1 more week until I get to see my @toothfairyknz 😁🤏🏻 just a little bit excited ❤ . . . . 👑🦷👑 . . . . #labqueen #jtlabqueen #dentalart #waxup #dental #dentures #denture #partials #ivoclarvivadent #tooth #odontologia #dentaltechnician #handmade #dentalphotography #prosthesis #teeth #dentist #smile #smilemakeover #prosthetics #waxcarving #dentalwork #cosmeticdentistry #dentalstudent #dentistrylife #dentistry #odontology #dentallaboratory #denturebabes #cantstopwontstop - @jtlabqueen on Instagram

- Back with another extraction, this time my sisters upper wisdom tooth that had a cavity

- Dr. Wong Social Media Mood Board

Что нужно обязательно сделать перед установкой брекет-системы? Прежде всего, на консультации мы знакомимся с пациентом и определяем, можно ли ему поставить брекеты. После консультации мы: ⚪️ направляем пациента на рентгенологическое обследование 🔹 снимаем слепки челюстей ⚪️ изготавливаем гипсовые модели челюстей 🔹делаем расчеты всех этих обследований ⚪️ составляем план лечения ⠀ Мы с Вами обсуждаем и утверждаем план лечения, и после этого можем быть готовы к фиксации брекет-системы👌🏻 Не забудьте сделать селфи до лечения и будьте готовы к преображению Вашей улыбки 😍 ⠀ На фото металлические брекеты Victory с цветными лигатурами 💙 ⠀ 📞 Запись на прием|консультацию через WhatsApp по ссылке в шапке профиля 👆🏻 📍Баррикадная 🖥 www.makesmile.ru ⠀  #ортодонтмосква  #стоматологиямосква #брекеты #braces - @doctor.dementeva on Instagram

- I have tentacles under my tongue- apparently not everyone does?

#newwork • Chichicastenango, Guatemala, 2019 • More than 90% of the material people are putting in their mouths up in the highlands is not gold, cheaper options are being imported from China in massive amounts. Oral, esophagus, stomach and colon cancer cases have more than tripled in the last decade, according to many local dental technicians. • After I finished shooting Tonatiuh, I needed to go back to the highlands and reach deeper into a new aesthetic developing up in the mountains, those densely populated towns are a vast source of images, images that document how the new generation understands their origins and are shifting to new trends, specially for their attire, their way of absorbing globalization and the genesis of a new “bourgeoise”. Gold is still very important, or at least the idea of it, my research is in progress and Im fascinated with the extent these individuals would go to look opulent, to play the part. • The Guatemalan highlands define our identity in so many ways, Im fascinated by the beauty of the region but more than anything by its complex reality. This new body of work focuses on a new generation, a new aesthetic, globalization and the inevitable abandonment of very old practices that once defined us as a nation; as a territory. • #juanbrenner - @juan_brenner on Instagram

- These Molar Teeth Nails

As simple and predictable as it can be! #vascularity #modifiedtunneltechnique #dentistry #dentist #periodontist #surgery #dentalphotography #perioplasticsurgery #periosurgery #periodontalsurgery #keratinizedtissue #connectiverissuegraft #connectivetissue #mucogingival #rootcoverage #laminapropria #josenart #uicperio #uicperiofaculty - @josenart on Instagram

Watch the unraveling of severely crowded upper teeth following extraction of upper first bicuspids. A simple TPA (Transpalatal Arch) soldered to a Nance button was used to maintain maximum anchorage. Its one year in treatment and there is already a significant improvement in facial profile, although due to the high mandibular plane angle, surgical correction would have been ideal had the patient agreed to it. Although we usually advocate for doing our best not to take teeth out, sometimes it is the only way to achieve harmonious occlusion and stability. #orthodontics #braces #anchorage #extractionsarenottaboo #hashtags #teeth #ucla - @samkenawy on Instagram

- braces

Well never get tired of seeing ICON transformations, heres another beauty thanks to @omarouane... Enjoy!⁣ ⁣ #DMG #DMGDental #icon #innovation #whitespots #dental #dentistry #aesthetic #restorative #cosmeticdentistry #transformation #beautiful #results - @dmgdentaluk on Instagram

We love being tagged in your fun photos like this! 📸 We have such a creative community!⠀⠀⠀⠀⠀⠀⠀⠀⠀ PC @paige_kelly - @dentalgirlgang on Instagram

نەشتەرگەری چاندنەوەی پوک و ڕاستکردنەوەی ددانەکان 🦷 - @arsa_dental_clinic on Instagram

- Blursed Tooth

Viva a Endodontia !! . . #repost @profmleonardi . . . . . . . . . #endo #dentistry #endolovers #sessaounica #endodontiadodia #endodontic #tratamentodecanal #vidadedentista #endodontia #retratamentodecanal #endodontic #retreatment #endodonticespeciality #odontologia #odontologiadicas #endolover #endobrasil #endodontie #endodontictreatment #endodontics #microscopio #endoinformacao #magnificação #magnificaçãoemodontologia #caseoftheday #dentistaemacao #rootcanal #rootcanaltreatment #rootcanals #mklife_ - @endolife_ on Instagram

Ryan Murphy anunciou que a produção de #AHS10 começará em Outubro! Ele aproveitou para deixar uma pista através da imagem acima, que é a dentadura do Pennywise vendida pelo site Mostly Dead. - @ahsbrazil on Instagram

- Brampton Dentist

- Braceface

Done by Dr. Michelle Su Smile with confidence, Smile perfectly, Smile with a brighter teeth with Smileway 💎 Case by Dr. Michelle Su @michellesyh #compositeveneers #aestheticdentistry #cosmeticdentistry #smileway #smilewaysetapak #drmichellesu - @smileway.dental on Instagram

Partners in Excellence are ready to help you with your conversions and solid zirconia implant hybrids! Call us today to schedule.⠀ call: (800)510-9286 email: info@adar.net⠀ ⠀ #AdarDentalNetwork #PinhasAdar #DigitalDentistry #DominateDontCompete #AdarDental #GetTheLookOfAdar® #LHDDS #LarsHansson #AdarSuccessAcademy #DominateYourMarket #Conversions #SolidMonolithicZirconia #MonilithicZirconiaHybrids #FullMonolithicZirconiaSmileDesigns #Commitment #ImplantHybrid - @pinhasadar on Instagram

- Smile Makeover

- Affordable dentures

Starting teeth whitening for September!! Call to book your appointment! Normally $100, only $80 for all of September!! Get a confidence boost with brighter, whiter teeth!! #teeth #white #bright #confidence #beauty @beauty.bygiulia #discount #backtoschool #special #service #ig #igers #cutmaster #cutmasterhairsalon #heritageplaceshoppingcentre - @cut_mastersalon on Instagram

¿Y que mas podemos aspirar al recibir esta publicación? #Repost @yotzifloresortodoncista (@get_repost) ・・・ Es posible un tratamiento de ortodoncia que proteja periodonto y el esmalte dental? Es posible un tratamiento de ortodoncia que aún como factor de riesgo a caries y enfermedad periodontal permita que el paciente no desarrolle estas entidades? Pues le comentó que si! Y no es responsabilidad exclusiva del paciente (dominio de técnica de cepillado, uso de enjuague bucal, adecuada alimentación durante el tratamiento), sino de una correcta evaluación del Ortodoncista en relación al diagnóstico de Caries y a la determinación del Riesgo a Caries del paciente al momento que decide ser evaluado para recibir tratamiento de Ortodoncia, si cómo lo escuchas! Es responsabilidad del Ortodoncista conocer aparte de lo concerniente al Diagnóstico de su especialidad, la información actualizada a la correcta evaluación del sustrato donde trabajará (esmalte, periodonto ...) para con criterio sólido decidir si el paciente es candidato a tratamiento de ortodoncia, desde una visión integral! En la imagen paciente con 19 meses de tratamiento de ortodoncia, en perfecta condición periodontal y libre de caries! Hacia una Ortodoncia Responsable, gracias @alfredo_natera por la semilla sembrada estoy segura que verás la cosecha! - @alfredo_natera on Instagram

- braces

- Dental Assistant humor

- Torus palatinus - a benign bony protrusion of the palate

- 1NFERNO

ZrO2 + e.max. Коронки на имплантатах и Виниры. Работа проводилась в несколько этапов: 1) моделировка, согласование проекта; 2) прототип; 3) примерка прототипа; 4) небольшая коррекция после примерки; 5) фрезеровка циркониевых каркасов; 6) печать каркасов под пресс; 7) прессовка; 8) нанесение керамических масс. Работу выполнила: @toksarova_ Моделировка: @compton_east_cadcam Врач: @emil_hasyanov #виниры #emax #стоматология #зубнойтехник #винирыказань #винирымосква #exocad #стоматолог #veeners #tooth #Dentist #Smile #зуботехническаялаборатория #коронки #зубки #ортопедия #протезированиезубов - @compton_east_cadcam on Instagram

- Braces

E quando ao terminar uma Reabilitação Oral , você remove placa da impressora e percebe que ela praticamente encaixa perfeitamente no modelo do enceramento diagnóstico e no modelo final ... 😁😁 #primescan , #cadcamcode , #Cerec , #intersection - @sergio_meiga on Instagram

- @sannetuithof on Instagram

- Happy dental

- dental

- Dental Bridge

- Helpful Tips

- Emoji grill

- My little cousins teeth

- Buy Silver Liquid Mercury Online at affordable price

- Anatomy Face

- Power chain braces

- When the dentist screws you

@galushko.natalia #стоматологическаяклиника #стоматологиямосква #стоматологортопед #лечениезубов #зубныетехники #зубныепротезы #протезированиезубов #протезированиенаимплантах #зубы #виниры #люминиры #безметалловаякерамика #белоснежнаяулыбка #металлокерамика #импланты#dent#dentallaboratory#dentist#dentalart#dentallab#dentalphotography#dentalschoomoscowl#dentalstudent#dentaltech#waxup#stomatologiechisinau - @dental_techniques on Instagram

- Lingual Braces

- Braces

- Tooth cartoon

- Gold Braces

Ocean Gradient @grillz 🌊🏄🏿‍♂️ 10 on 10 14k White Gold from deep ocean Blue sapphire, to Clean white VS diamond tips 💎 For NBA star @gmb_elchum3 #TheGoldsmith #Aquatic - @maisonraksha on Instagram

- Teeth health!!

- hmmm

- Kid wouldnt stop sucking his thumb, sooo...

- Teeth & Art

Três ( 3 ) Fístulas, já pode pedir música ? Foto do Dr. @drvaltecioodontologia . . . . . . . . #endo #dentistry #endolovers #sessaounica #endodontiadodia #endodontic #tratamentodecanal #vidadedentista #endodontia #retratamentodecanal #endodontic #retreatment #endodonticespeciality #odontologia #odontologiadicas #endolover #endobrasil #endodontie #endodontictreatment #endodontics #microscopio #magnification #magnificação #magnificaçãoemodontologia #caseoftheday #root #rootcanal #rootcanaltreatment #rootcanals #mklife #divuldonto - @endolife_ on Instagram

- gold rate india

- Cute braces colors

Great regeneration requires step by step approach. Not always the time for bone augmentation is the best for soft tissue procedures. These pictures are from the second surgery, done only for soft-tissue improvement. A great honor to do this case with my old friend my guru for bone reconstruction André Zetola Uma grande regeneração requer uma abordagem passo a passo. Nem sempre o momento para aumento ósseo é o melhor para procedimentos de tecidos moles. Essas fotos são da segunda cirurgia, feita apenas para melhora do tecido gengival. É uma grande honra fazer este caso com meu velho amigo e meu guru para reconstrução óssea. Essas fotos são da segunda cirurgia, feita apenas para melhora do tecido gengival. É uma grande honra fazer este caso com meu velho amigo e meu guru para reconstrução óssea André Zetola! - @ricardo.kern on Instagram

#Repost @rodrigocavaco ............................................. ⬅️ Swipe left ............................................. 👉 Follow @firstdentistry ............................................. Single crown. . . . . . . . #tooth #odontologia #dentist #dental #dentistry #firstdentistry #dentista #dentalphotography #smile #dentalassistant #dentalcases #artdental #dentalcare #dentalworld #dentalstudent #odontoporamor #stomatology #dentaltech #dentistrylife #regram - @firstdentistry on Instagram

discards for an upcoming thing w @mariavfaldini - @davidggguerrero on Instagram

- A Freshwater Pearl in the Shape of Some Teeth

- These lovely teeth

PIOGENIC GRANULOMA Benign injury. Consisting of granulation tissue, it originates in the connective tissue of the skin or mucous membrane. It is considered a reactive and multifactorial lesion related to repetitive aggressions, trauma, local irritants and poor oral hygiene. It most often affects adolescents, young adults aged 11 to 40, located more in the maxilla than in the jaw. . HISTOPATHOLOGICAL Lesion covered by stratified squamous epithelium. Underlying, fibrous connective tissue. With proliferation of blood vessels, varied calibers, sometimes congested. Has a lymphoplasmocyte inflammatory content. TREATMENT The treatment of these injuries consists of surgical excision. Via: @jannamaxilo & @patologia.bucal 📷 NEVILLE, Brad W. Oral & maxillofacial pathology. 2. ed. Rio de Janeiro: Guanabara Koogan, 2004. xviii, 798 p, il. . www.dandal.ir . #dentalschool #dentalstudent #dentist #dentistry #stomatology #medicine #medical #medstudent #studentlife #farmacy #endodontics #cosmeticdentistry #aestheticdentistry #rubberdam #orthodontics  #braces #invisalign #prosthodontics #dentallab #veneers #periodontics #implantology #omfsurgery #surgery #oralsurgery #pedodontics #dentalhygienist #dentalassistant #oralhealth #dandal - @dentists.doctors on Instagram

Socket shield step by step - @alberto_miselli on Instagram

Busy Busy Sunday after a 2 day Implant Training Course ✌🏼 . . . . 👑🦷👑 . . . . #labqueen #jtlabqueen #dentalart #waxup #dental #dentures #denture #partials #ivoclarvivadent #tooth #odontologia #dentaltechnician #handmade #dentalphotography #prosthesis #teeth #dentist #smile #smilemakeover #prosthetics #waxcarving #dentalwork #cosmeticdentistry #dentalstudent #dentistrylife #dentistry #odontology #dentallaboratory #denturegang #tiktok - @jtlabqueen on Instagram

💡O uso dos elásticos com força leve no início do tratamento é essencial e muito eficaz. - @milanimichelletti on Instagram

- Caught this close-up of my cats open mouth. Thought her tongue and hard palate looked super cool!

- Smile teeth

Do you know the reason for the alastics to be covering/fixating only half the brackets wings? Comment below! [I dont.] Picture by @drmsadekli . . . #orthodontics #ortodoncia #ortodontia #braces #brackets #biomechanics #health #dental #odontologia #odontolovers #odontologos #odontologiaespecializada #dentistry #dentalphotography #dentalworld #dentalmyworld #ensenada #ensenadabc #ensenadamexico #dentist #dentista #dentalclinic - @straight_smile_ on Instagram

- Funnies!

🔴⚜️¿Por qué hacerte la #bichectomía ??⚜️ • ✨Tener una apariencia joven, es sinónimo de salud y frescura en el rostro. • 💎Un perfil afilado y delgado es una manera de obtener mayor estética. En este contexto existen técnicas quirúrgicas que buscan obtener este resultado. • 👁‍🗨La bichectomía a pesar de no ser un procedimiento nuevo ha logrado tener una gran popularidad en la actualidad por sus increíbles resultados estéticos. • 💎La cirugía obtiene sus resultados sacando grasa de la mejilla, también conocida como “bola adiposa de Bichat”. Esto promueve un pómulo más prominente. • 👁‍🗨Se realiza una pequeña incisión en la mucosa oral (por dentro de la mejilla), sin dejar cicatriz visible, bajo anestesia local: SIN DOLOR. • 💎👨🏻‍⚕️La bichectomía no es para todos los casos, debe ser bien indicada y muy bien planificada. - @black.molar on Instagram

- Dental Assistant

Put your money where your mouth is. - @stevezeitzoff on Instagram

- Gold Slugs

My top 10 favorite smile makeovers #top #10 #favorite #best #smiles #perfect #beauty #pretty #beautiful #wow #makeover #transformation #crazy #teeth #hygiene #dentist #dentistry #smile #love #this #smileagaindental - @drkennysmiles on Instagram

- Dental Braces

El objetivo mas conocido de un tratamiento de ortodoncia es brindarle al paciente una bonita sonrisa 😁 Pero lo mas importante es lograr un correcto alineamiento dentario y una buena oclusión, para una mejor estética, función y salud periodontal. Mismo objetivo, distintas opciones: ✔️Brackets Convencionales ✔️Brackets Auto-ligado ✔️Brackets Zafiro ✔️Brackets Cerámicos Valoración total☺️😁mente GRATIS 🤩 Agenda tu Cita 📲 3️⃣1️⃣8️⃣3️⃣0️⃣2️⃣3️⃣5️⃣6️⃣1️⃣ Calle 4 # 16 - 57 Br. Hacaritama (V/cio) - @sonrisalud_20 on Instagram

- DAVID BOWIE

- Thanks, I hate a hairy tongue.

- I cant imagine this works well for grinding your food.

- @sannetuithof on Instagram

- Russian cufflinks

- Brace face

- Snap on smile

- Power chain braces

- Braces retainer

#Repost @toothfairyknz ・・・ Sequence pic Monday. I’m desperate to wake up. 🥱😴 #dentaltechnicians #dentistry #dentallaboratory #dentures #completedentures #toothcreep #denturebabe #dentaltech - @odontologiapreventiva on Instagram

- Braces wish board

- Human Anatomy

- Lingual Braces

• Via @dental_mentor 👉👉 @orthodontic_mentor For More! Via @operationsmile Get Your Dental Photography Gadgets From Our Online Store @dental_mentor ✅———————————————————————— ▪️Black Contraster. ▫️ 5 Sided Intraoral Mirrors. ▪️Premium Lip Retractors. ▫️Super Macro Lens For Smartphones. ▪️Led Ring Flash For Smartphones.▪️Premium Dental Loupes ———————————————————————— Link in 👉 @dental_mentor #Orthodontic_mentor #orthodonticmentor #dental_mentor #dentalmentor #dentistry#dentist#rct#rootcanaltreatment#dentaltrends#dentistrysociety#dentalife#teeth#cosmeticdentistry#dentaltreatment#dentistlife#lifeofdentist#smile#clearaligners#clearaligner#invisalign#oralsurgery#grafting#periodontics#habits#pedodontics#medicine#orthodontics #braces #orthodontist @gabriel.barberio - @orthodontic_mentor on Instagram

#Repost @dhpro.oficial ・・・ Fortalrcer a saúde e a energia para o trabalho. Estar perto, mesmo que da forma digital, as pessoas que nos ajudam e incentivam esta caminhada. como meu irmão e Grande Professor @rafaelcortazzo que sempre me ajuda em projetos . Lembrança Ciosp 2020. - @dhpro.oficial on Instagram

- ARE YOU KIDDING???

- Cute girls with braces

- Braces

@mbishara86 ・・・ 💥💥A different yet beautiful smile transformation 💥💥 . . Provisional phase completed ✔️ . . This failing grill was being held by non restorable teeth and almost came out in the preliminary impression. Maxillary implant retained FDP (all on 4) was provided and immediately loaded. This is the provisional/temporary and any changes later could be made transitioning into the definitive prostheses catering to our patient’s needs and preferences. . . . Shoutout to our amazing surgeon, lab tech, staff and assistants for a job well done. - @cosmeticdentists on Instagram

- Since yall liked my last post, here is the myxoma I am hopfully going to have removed soon. This was after the biopsy. Doctor said that it is a rare kind of myxoma that has bone in it. Sorry for this one not being as gross as my last

functional orthodontic therapy and Damon System #ortodonzia #orthodontic #damonsystem @davide_damiola @poliambulatoriodamiola - @damon.club on Instagram

Positions of the wisdom 🦷😷 - @dentistry.home on Instagram

Покопался в архивах. Цельнолитой винир коронкового типа 360° прессованный фрезерованный литой NiCr. #коронка #селфи #виниркоронковоготипа #люксанир #ананир #dentalphotography #dental_pictures #dentalart #dentaljokes #dentistsworld99 - @dr.raphael.shcholk on Instagram

Posted @withregram • @antalicandro Open bite invisalign treatment -invisalign treatment #invisalign #simile #aesteticsdentistry #passion #love #orthodontics #orthodontist #dentist #dentalphotography #dentalarts#braces#biomechanics @ortho.love orthorepost @orthopost @ortho.news - @orthopost on Instagram

Reposted from @justin_glaister Next level isolation @drjosema_ayub #dentistry #cosmeticdentistry #veneers #porcelainveneers #estheticdentistry #aestheticdentistry #smiledesign #dentalphotography #smilemakeover #beforeandafter #dentallab #rubberdam #digitaldentistry #compositeveneers #teethwhitening #orthodontics #invisalign #minimallyinvasivedentistry #biomimeticdentistry - @dental.7 on Instagram

- My temp dentures.

- Braces tips

- Braces

12 year old boy. First child of a healthy couple, not consanguineous, gestation without problems. It presents a wide and complete bilateral cleft palate, together with membranous bands connecting the margin of the cleft palate with the floor of the mouth, lateral to the tongue bilaterally, present since birth. Via: @dentalhealtheducation 📷 Comment your thoughts and share with your friends. 📣 Dont forget to use the #dentistbyheart hashtag. ✔ Follow @dentistbyheart for more. 😷 #dentalschool #dentalstudent #dentist #dentistry #stomatology #medicine #medical #medstudent #studentlife #farmacy #endodontics #cosmeticdentistry #aestheticdentistry #rubberdam #orthodontics  #braces #invisalign #prosthodontics #dentallab #veneers #periodontics #implantology #omfsurgery #surgery #oralsurgery #pedodontics #dentalhygienist #dentalassistant #oralhealth - @dentistbyheart on Instagram

- This custom sculpted lighter

Self explanatory #donthalveit - @discoveryourotherhalf on Instagram

- Cursed nails

- Brace face

- be ur own dentist

- Braces

😁😁😁 my bite - @richardprince_official on Instagram

- chipped tooth

So many to pick from!!! Go pick out your favorite at www.dentaldistortions.com #fxteeth #fxmakeup #fxmouth #faketeeth #orc #monster #troll #completeyouroutfit #cosplay #costume #customteeth #finishingtouch #professionalproducts #scarymouth #vampirefangs #mua - @dental_distortions on Instagram

Hoje foi dia de desgaste dentário em roedor - @danielapjunqueira on Instagram

- My dogs perfectly white and symmetrical teeth. Snapped it while it he was holding the frisbee, lol.

- Blursed teeth I guess?

- Grillz

Muchas gracias a @jandro_diaz_perez e @ivoridental por este magnifico material🙏🙏🙏🔥🔥🔥 #3shape #laboratoriodental #protesisdental #dentaltechnician #dentaltech #smilemakeover #dentallab #dentalart #waxup #fulldentures #exocad #waxup #digitalsmiledesign #digitaldentistry #cadcam #ivoclarvivadent - @javi_p4ris on Instagram

- Since you guys liked my last stones, heres a tonsil stone I just popped out

Lusage de la tétine empêche les dents dévoluer correctement ,car il crée une béance dans laquelle passe la langue, Lenfant continue alors de déglutir comme quand il était bébé, déformant ainsi ses maxillaires ‼️ Follow for more @dentistry_care . Via : @dra.simonedifiore . . . . . . . . . . . . #dentist #dentistry #dentiste #dentaire #dentalstudent #dentistecasablanca #odontopink #endodontics #endodontie #pedodontics #odontologia #parodontologie #odontolovers #odontopediatra #cabinetdentaire #medecinedentaire #odontólogos #odontologiaestética #odontolife #odontohumor #dentistlife #maroc #طبيبة_اسنان #dentalart #dentallab #oralhealth #dentisterabat #oralpathology #طبيب_اسنان - @dentistry_care on Instagram

- Foods for Braces

- Invisible braces

Adquira seu modelo, @valterabreu01 os melhores modelos pra você, Get your model, best models for you to find here Obtenga su modelo, los mejores modelos para encontrar aquí - @ertealmeida on Instagram

- ARE YOU KIDDING???

PROMOSI 3 PASANG RM100 FREEPOST + FREEGIFT SAMPAI HUJUNG BULAN SAHAJA GUYSS !! 👏👏 . . Nak beli atas / sepasang pun boleh 💕 🌸Atas saja RM40 🌸Atas bawah RM50 FREEPOSTAGE 🎉 . . 📲Berminat terus dm atau whatsapp 01137506137 . #braces#bracesmurah#fakebracesmurah#realbraces#realbracesmurah#realbracespekan#realbraceskuantan#braceskuantan#realbracespahang#bracespahang#realbracesgambang#realbraceskl#realbracesmelaka#realbracesmalaysia#clickbracesmurah#clickbraces#clickbraceskuantan#clickbracespekan - @dhiyacollections_ on Instagram

Forever learning and upgrading my skills as a dentist, dental boss and coach. It’s all smiles! #thecheekydentist #dentalcoaching #dentalogic - @thecheekydentist on Instagram

- Dental Bridge

- Beauty and the Beast Costumes

What a nice surprise reading Dentista, thank you Maarten for this beautuful article and case. - @oral_design_erikm on Instagram

- Cute braces colors

- hmmm

Cirurgia de Recobrimento Radicular, usando tecido conjuntivo retirado do Palato. Técnica de túnel para fechar recessões gengivais, técnica Vozzhey (por Zabalegui, 1999). • Cirurgia realizada por @dr.aleksandr_drots • ❗Confira nossos produtos em nosso link da bio❗• • ⏺ MANEQUIM UTILIZADO: 📍Manequim Especialização Periodontia (Perio SG) ✅Gengivectomia de 13 à 23; ✅Retração gengival do 14, 15 e 24, 25; ✅Gengiva em 2 cores simulando tecido epitelial e conjuntivo; ✅Remoção de tecido conjuntivo; ✅Área para implante nos dentes 16 e 26; ✅Enxerto Epitelizado; ✅Enxerto Conjuntivo; ✅Cunha Distal; ✅Correção de Rebordo (enxerto misto e enxerto mucoso); ✅Enxerto em Rolo. • • • #dentistry #dentalvideo #odontologia #prótese #prosthesis #identistry #dentalimplants #odonto #periodontology #perioplasticsurgery #esthetics #gum #graft #dummy #implantesdentarios #implantesdentales #dentalwork #dentalphotography #fotografiaodontologica #teeth #implant #implantdentistry #tooth #dentistryworld #dentist #prosthodontics #odontologia #odonto #orais #oraismanequinsodontologicos #oraismanequins - @oraismanequins on Instagram

- Beauty

- Braces Rubber Bands

- mouth grills

- Braces

- Fashion jewelry

- Braces color ideas

- You can operate your computer by your tongue

End of the month with a million and a half cases left to be processed. Mostly my IvoBase babies. Yes it takes a front staff to create a welcoming & supportive environment for our patients but it also takes a kickass dedicated Technician to slam out predictably beautiful work to keep patients coming back & spreading the word to family/friends. Us as Technicians are usually left in the dark shadows of our Lab not getting much recognition for our hard work but sleep peacefully knowing how grateful our patients are for us and the smile we crafted for them with love. Ill always love what I do knowing I gave someone back their smile and their ability to eat their favorite foods. Technicians Rock! . . . . 👑🦷👑 . . . . #labqueen #jtlabqueen #dentalart #waxup #dental #dentures #denture #partials #ivoclarvivadent #tooth #odontologia #dentaltechnician #handmade #dentalphotography #prosthesis #teeth #dentist #smile #smilemakeover #prosthetics #waxcarving #dentalwork #cosmeticdentistry #dentalstudent #dentistrylife #dentistry #odontology #dentallaboratory #weareaesome #ilovemyjob - @jtlabqueen on Instagram

- Brackets

- Brace face

- Cursed_Toothbrush

- Open face grillz

- Bite me!!!!

Add the option of digital orthodontics to your practice! Accusmile® , from FORESTADENT, allows orthodontic practices the need-based digital planning and fabrication of aligners. Benefits include; ✨Flexible Process - you get to choose which steps you would like to do yourself ✨Treatment plan can be revised and adapted at anytime ✨Can be split into several treatment stages ✨No need to buy or lease additional software ✨No need to attend time consuming and costly certification courses Click the link in our bio to learn all the benefits Accusmile® has to offer! Call 1-800-721-4940 to get started!! #orthodontics #clearaligners #indirectbonding #orthodontist #orthodontistassistant #digitalorthodontics - @forestadent_usa on Instagram

Via @asliceofbambi - @sharnaosborne on Instagram

✊✊✊✊👍👍👍 @radaev_anton #dentist #dentallab #emax #stomatology #porcelain #dentalphotos #dental#зубнойтехник#пресскерамика#безметалловаякерамика#виниры#металлокерамика#зубнойпротез #waxup#стоматолог#стоматологортопед#протезирование#зубы #зуботехническаялаборатория#стомат#виниры#ровныезубы#emaxpress#radaev_group#radaev_anton - @azamatar_dent on Instagram

- Braces colors

- quiet, me, digital, 2020

- Post extraction last week. Man, that tooth was big! (Sutures, there, along the top)

- My friend has clear braces on his top teeth regular braces on his bottom teeth

- Custom Jewelry

- Dental Braces

- @pedro_costa_monteiro on Instagram

- Braceface

- Braces Rubber Bands

- Lingual Braces

- Brace face ♡

- Some vampire teeth charms I’ve made ready for Halloween. The teeth are white Fimo and the blood drop is translucent red. 🧛‍♀️ 🧛‍♂️

- Fashion oral braces by an unlicensed dentist

- Fix teeth

- Nail teeth

Antes y después del tratamiento de ortodoncia en modelos de estudio. Before and after orthodontic treatment in study models #tratamientodeortodoncia #orthdontictreatment #ortodonciamexico #mexicoorthodontics #mexicoorthodonticstreatment #ortodoncia #orthodontic #ortodoncista #orthodontist #vdmx #ceovfa #ceovfamx #drajoanacampolargo - @dra.joanacampolargo on Instagram

🔥🚨 BRING DIGITAL DENTISTRY to a new LEVEL with HQ VISUALISATIONS👌🏻This time  I would like to share one of my PURE NATURAL DIGITAL SETUP CGI - LOWER. DONT FORGET If you are looking for professional  dental CAD service  please contact me... ⠀ VISIT MY SHOP FOR LIBRARIES 👇⠀ https://sellfy.com/dentalcadshop⠀ https://sellfy.com/dentalcadshop⠀ ❗ Follow my account @lorant.stumpf for more... ❗⠀ 📌Turn On Post Notifications📌👈👈 ⠀ #dental #veneers #dentistry #dentistryworld #dentistrylife #dentistrylove #dentalphotography #dentallab #dentalart #cadcamlab #cadcamcenter #cadcamdental #veneers_smile #cadcamdentistry #dentistrysociety #cadcamjewelry #dentaltechnology #dentistrylover #dentalife #dentistrymylife #aboutdentistry #dentistrytoday #digitalbusiness #digitallyart #veneerporcelain - @lorant.stumpf on Instagram

Successful orthodontic treatment of a cat 😸😱 Follow👉@dentistryfoundation for more #veneers #braces #extraction #surgery #dentistry #dental #dentist #cosmeticdentistry #odonto #odontologia #dentalclinic #gingivcectomy #laser #dental #doctor #odont #dentalhygiene #dentalhygienist #gums #gumsurgery #dentalstudent #teeth #animation #dentista #video #dr #surgery #orthodontics #orthodontist #smile #teeth #medical - @dentistryfoundation on Instagram

- Braces

6unit anterior before/after - @mohamadks68 on Instagram

⛲ - @juanita.care_ on Instagram

- Picked up my new retainer at the dentist today and the box included a 3D printed copy of my teeth.

- Braces

- cute colors for braces

My biggest takeaway from this case was a greater appreciation for how much harder it is to place implants in the edentulous maxilla. Wearing loupes and working sideways or upside down made it that much harder to parallel my implant placement while staying consistent with the occlusal plane. That coupled with crappier bone, and more critical aesthetic challenges makes me realize why more clinicians guide this surgery. Local anesthetic management was also more challenging for me compared to the mandible. In the end it was a great learning experience and I’m excited for the next one. - @smilesbydr.brasher on Instagram

@ertealmeida Adquira seu modelo, @valterabreu01 os melhores modelos pra você, Get your model, best models for you to find here Obtenga su modelo, los mejores modelos para encontrar aquí - @zubnietexniki on Instagram

- Our first, fully functional, fully 3D printed Denture! This will be out economy level denture. Both the Gingeva and the Teeth are printed with their Denture Base resin and their A1 Teeth resin. And yes, this is an FDA approved product.

#implant چاندنەوەی ددان بۆ چارەخوازێک 💯 - @arsa_dental_clinic on Instagram

Repost @totalart.dental.lab Immediate prothese #dentalphotography #dentallab #zahntechnik #dentalart  #tecnicodental #dentaltechnician #aestheticdentistry #stomatology #protesistotal #dentalschool #dentalgram #зубнойтехник #prostheticdentistry #стоматология #stomgo #dentaltehnikal #prostodoncia #tecnicodental #odontology #dentaldesign #zubnitehnicar #dent #dental #totalart #totalartdentallab #immediateimplant - @discovery.dentistry on Instagram

- Low cost dental care

- Gold dentistry is best dentistry.

- Health / Salud

Occlusal canting therapy by @dr.edmitry These are TMA, SS or CuNiTi 18x25 wires with individual bends by @dr.edmitry . . . #orthodontics #ortodoncia #ortodontia #braces #brackets #biomechanics #health #dental #odontologia #odontolovers #odontologos #odontologiaespecializada #dentistry #dentalphotography #dentalworld #dentalmyworld #ensenada #ensenadabc #ensenadamexico #dentist #dentista #dentalclinic - @straight_smile_ on Instagram

- cute colors for braces

A few strange and wonderful fang sets that Ive had the pleasure to create. 😁 - @kaoskustomfangs on Instagram

- my uvula has a uvula

- This squishy thing under my tongue..

- hmmm

- Cursed_Brace

- Braces wish board

Drug-induced gingival overgrowth. This is probably the most severe case of DIGO I have ever seen in practice. 40 YO male. With multiple medications. One of which was.. you guessed right “Nifedipine” which is calcium channel blocker. He was taking it to treat his hypertension. Management will be: 1- Medical 💊Discontinuation and/or switching over to another drug (without the same side-effects) 2- Surgical 🔪 Gingivectomy to remove the excess gingiva 😃. 💊 💊 💊 💊 💊 #perio #periodontist #periodontalsurgery #periodontia #periodontista #odontolove #dentalphotography #dentistry #dentista #odontology #odontologia #stomatology #oralsurgery #cirugiabucal #cirugiaoral #dentalstudent #dentalhygiene #surgery #dentalesthetics #gums #newsmile #topdocs - @topgum1 on Instagram

- Cursed_teeth

- Teeth Care

- Dope

Im working on a new piece right now, I cant wait to share it with you 🦪 - @juanita.care_ on Instagram

- I have two uvulas

- grills teeth

- Because we all have Tom Cruise teeth