Goes Viral Profile Pics

viraltrendingpopularfamousit went viralgoing viralviral videogo viralits gone viral
saturday glitch gif supreme vhs

Makanan yang lagi viral Odading Mang Oleh Antrean panjang terlihat di sekitar tempat berjualan odading mang oleh Odading Mang Oleh viral setelah review dari mang @m.adelondok Ada yg sudah mencobanya warginet? . . . Jangan lupa jaga jarak, pakai masker, dan cuci tangan ya . . . [ via @prfmnews ] - @info_padalarang on Instagram

gone viral gone viral game video game brawler roguelite

Making noise! What sounds better the V or Camaro? #cars #car #fast #cadillac #like #V #ctsv #ctsvnation #lspower #carsoflightspeed #corsa #lsa #camaro #ss #supercars #carsofinstagram #lsx #lsnation #sedan #carporn #instacars #speed #instacar #blackmusclecars #amazingcars #luxurylifestyle #racing #bhfyp #hooligan #copperstatecadillacs - @gapillac on Instagram

grass grass homestuck cool john egbert hi grass

La nouvelle collection @supremenewyork x Les Schtroumpfs sera disponible ce jeudi 1er octobre 🥶 Tous les détails via le lien en bio 🔗 - @lesitedelasneaker on Instagram

anis tiktok annaba dance

#repost from @elokadiprianto aiHitam yang di batasi putih & kuningai #vespaextremeindonesia #vespaextrememenolakpunah #pejuangextreme - @_magelangbacktoextreme_ on Instagram

tiktok tiktok pa more ivillero irishvillero tiktok dance

Arvo sesh at bracken 🛹 - @coreynixo_ on Instagram

it went viral lisa alexandra coco lili it blew up it became trending

Sunday morning ride meet the twins repsol...🥂😁🙏 . . . #indonesianbikers #repsolhonda #hondacbr250r #cbr250r #sunmori #cbr250repsol - @ger29von on Instagram

rilakkuma divider

Bmw S1kRR or Honda Cbrr?😎🔝. via @superbbikers @boy_veronezi @t94.z - @motorcyclemafia on Instagram

tik tok i did my dance baby

Aparat TNI berseragam lengkap katanya ditugaskan oleh Presiden Jokowi dihadang Masyarakat Adat Rakyat Penunggu Kampong Durian Selemak, Langkat - Sumatera Utara yang memihak untuk mengamankan rencana PTPN II yang akan mengokupasi wilayah adat untuk perkebunan tebu... #HTN2020 #60TahunUUPA #TolakOmnibusLaw #BubarkanPTPN #SahkanRUUMasyarakatAdat - @rumah.aman on Instagram

default dance

- Uhh blyat

you went viral for real this time seriously famous im not kidding kevin williams

- Fax💯

alina sanchez net art meme sticker poem

- Banana language

knives million knives trigun trigun knives pregnant

What should you do if you are driving and suddenly surrounded by rioters? I was talking to my good friend @damondamore from @legacymentorofficial - Damon trains and has trained with me and my team. We were discussing the peaceful protesters surrounding cars and beating people up and attempting to kill them and he asked me what the hell we should you do if surrounded - I decided to record my thoughts and share them with you. This podcast was my answer. It’s just 15 min. I swear. I rant. To listen go to @knowfearpodcast Then if youre fired up, if youre inspired - do something with that energy. (Some suggestions below) Mentioned in the call are @mike.a.glover @jackcarrusa @byron_rodgers @kawa_m_official @americancontingency Stay safe - remember the 31,000 ft view! Coach B Want to train with me or my team?  We dont teach fancy techniques. We teach people how to think. We teach people to manage fear. We teach people how to move naturally, instinctively. We explain how to train your brain because its the mind that navigates the body. At the moment you need to act decisively you cannot get more training or order more gear — therefore, everything you need to at that fight needs to have been developed or acquired prior to that fight. Reread that. At the end of the day...it’s the end of the day - and you want to make it there. Enter the CHOOSE SAFETY Law. To avoid danger at all costs starts with choosing safety - always. Do what you need to do to survive and that starts with deciding to choose safety now and that means you train before the fight. Again, stay safe out there. 🙏👊🙏 - @knowfearpodcast on Instagram

cares act stimulus wanted stimulus check tumbleweed

Follow @itzzz.cartierz and @niggainacage for more memes 🗣💯 - - - - - - #rapedits #bloodwalk #cripwalk #trapedits #litedits #slatt 2#ganggang #gangshit #gangedits #rapedits #repostthis #rapperedits #cripgang #cripedits #bloodgang #bloodgang#bloodedits #bloodgang #cripgang #hoodfights #hoodvines #hardedits #hoodedits #swishshit #slime🐍 - @itzzz.cartierz on Instagram

squadbot svu olivia benson viral kat tamin

Follow @ethical__hacking - @ethical__hacking on Instagram

in your dreams in your dre4mz raven raven joy r4ven

- They shouldn’t have released vanilla WOW

youre going to be blown away grace tkor the king of random youre gonna be amazed

❤ Dari facebook Raka Kusuma Wardana 𝙄𝙣𝙞𝙡𝙖𝙝 𝘼𝙠𝙨𝙞 𝘿𝙖𝙡𝙖𝙢 𝙈𝙚𝙣𝙮𝙖𝙢𝙥𝙖𝙞𝙠𝙖𝙣 𝙋𝙚𝙨𝙖𝙣, 𝘽𝙐𝙆𝘼𝙉 𝘼𝙆𝙎𝙄 𝙋𝙀𝙎𝘼𝙉𝘼𝙉 Rasa keprihatinan terhadap penegakan hukum yang terasa tidak seimbang dan adil, menggerakkan langkah ini tadi pagi sehingga saya berjumpa kembali dengan bpk @damaiwayan 🙏🏼 Saya sangat mengapresiasi beliau (mungkin lebih tepatnya salut kepada beliau). Bukan kali ini saja bersua, dalam berbagai kesempatan baik itu saat aksi #BaliTolakReklamasiTelukBenoa, ataupun dalam berpendapat seperti sekarang ini (aksi solidaritas #saveJRXSID) kami kerapkali bertemu. Kami sama-sama mempunyai rasa empati terhadap bli #JRX dan perspektif yang mirip bahkan sejalan, yaitu bukan keterbatasan/kekurangan secara fisik masing-masing dari diri kita yang menyebabkan rusaknya sistem hukum negeri ini, tetapi hilangnya rasa KEMANUSIAAN dan tertutupnya hati nurani yang membutakan KEBENARAN. Sakit jiwa penguasa yg semakin berkuasa dengan segala cara tidak bisa lagi diobati. Bagaimana dengan kalian? Tetap semangat team @gendolawoffice ✊ #SaveJRXSID #BebaskanJRXSID #OpiniTakPantasDiBui #HarusAdaTransparansiHukum #MafiaHukumDiBalikSidang - @ncdpapl on Instagram

Oknum guru SD Negeri seng inisiale AG (36) iki dibedek selingkuh karo wong wedok seng inisiale YS (29). Mandar, pasangan selingkuh seng dopodo nduwe keluarga iki tau nglakoni sawadikap skidipapap neng ruang kelas. LSM Bintara Tulungagung nglaporne perselingkuhan iki neng Dinas Pendidikan Pemuda dan Olahraga (Dindikpora) Tulungagung. . AG dan YS sama-sama sudah berkeluarga dan sama-sama sudah punya dua anak, dawuhe Pak M Ali Sodik, Ketua Umum LSM Bintara nggone SURYAMALANG.COM, Kemis (24/8/2020). YS wi ngunu bojone pekerja migran seng inisiale DY seng kerjo neng Taiwan. AG karo YS wes nglakoni hubungan terlarang telung taon terakhir. Malahan, pasangan selingkuh iki wes nglakoni hicikiwir neng kelas sampek ping telu pas AG mulang neng salah siji SD neng Kecamatan Kedungwaru. Pasangan selingkuh iki yo mbaleni nglakoni ena-ena pas AG pindah neng SD seng eneng neng Kecamatan Karangrejo. YS telah mengakui perbuatan itu karena YS kecewa telah dibohongi oleh AG. Pada akhirnya hubungan YS diketahui oleh suaminya. YS diceraikan sama suaminya dawuhe Pak Sodik. Bak-bak ting, AG dinggep ngingkari kabeh janji-janjine. YS seng kecewa karo AG akhire ngadu karo Pak Sodik. Barno nglaporlah neng Dindikpora Tulungagung. Korban sudah di-BAP oleh Dinas Pendidikan, dawuhe Pak Sodik. Kerono hubungan kuwi, YS sempet tekdung syalala gek digugurne aliase aborsi. Pak Sodik wes ngantongi kasus kuwi gek nilai AG ndak layak dadi pendidik, po meneh statuse PNS. Plt Kepala Dindikpora Tulungagung, Pak Haryo Dewanto Wicaksono ngaku wes oleh klarifikasi tekan YS. Hasilnya sudah dilaporkan kepada saya. Ada dua sekolah SD yang diakui jadi tempat berbuat (mesum), dawuhe Pak Yoyok. Lek pengakuane YS iki bener, AG dipastikne nglanggar etika. Molane iki rangkaian pemeriksaan ape dilanjutne ben oleh gambaran lengkap. Kami tidak ikut campur kejadian di hotel. Tapi mereka melakukan di SD. Itu pelanggaran berat, tegese Pak Yoyok. Pak Yoyok ngungkapne lek mbiyen AG mamangane guru seng statuse Guru Tidak Tetap (GTT). Terusno, AG njajal peruntungan neng rekrutmen CPNS Tulungagung formasi 2018. #Info lengkape neng SURYAMALANG.COM #KacamataTulungagung #Tulungagung - @kacamata_tulungagung on Instagram

viral discord skiing ostrich what

Semma Cute - @monishamonino on Instagram

loading

PILOT PESAWAT TEMPUR TNI AU YANG TERGELINCIR DI LANUD ISWAHJUD MENINGGAL DUNIA Pesawat tempur milik TNI AU jenis T-50i Golden Eagle tergelincir di Lanud Iswahjudi, Magetan Jawa Timur, pada 10 Agustus lalu. Salah satu pilotnya, Letkol Pnb Anumerta Luluk Teguh Prabowo, meninggal dunia setelah kondisinya sempat membaik. Betul (pilot meninggal dunia), cukup lama di rumah sakit ya, hampir 2 minggu. Itu kan ke rumah sakit Yogya dulu dan sudah membaik, tapi ternyata ada sakit yang lain. Golden Eagle. Nomornya TT 5006, ungkap Kadispen TNI AU Marsma Fajar Adriyanto saat dimintai konfirmasi detikcom, Rabu (2/9/2020). Kecelakaan pesawat itu terjadi pada Senin (10/8) saat dalam misi latihan. Ada dua pilot dalam pesawat yang tergelincir tersebut, yakni Letkol Anumerta Luluk sebagai instruktur dan Lettu Pnb Muhammad Zacky yang merupakan siswa. Fajar menyebut kedua pilot sempat keluar dengan kursi pelontar saat kecelakaan terjadi. Namun kondisi Letkol Luluk cukup parah saat jatuh. Perwira Akademi TNI Angkatan Udara tahun 2003 itu meninggal hari ini ketika menjalani perawatan lanjutan di RSPAD Gatot Soebroto, Jakarta. Kan ada luka-luka, kejadiannya kan setelah lontar, eject, sempat luka-luka dan dirawat. Untuk jelasnya kenapa meninggalnya, mungkin rumah sakit yang lebih tahu, di RSPAD, sebut Fajar. Luluk, yang sebelumnya berpangkat mayor dinaikkan menjadi letkol pnb. Sementara itu, Lettu Zacky masih menjalani perawatan namun kondisinya stabil. Masih di rumah sakit, luka bakar, tapi kondisinya membaik. Stabil, kata Fajar. Jenazah Letkol Luluk sudah diterbangkan ke Madiun. Penerbang TNI AU yang dikenal dengan julukan Wiggler itu akan dimakamkan di kota kelahirannya tersebut. Negara memberikan penghargaan kepada Luluk Wiggler Teguh dengan menaikkan pangkat satu tingkat lebih tinggi menjadi letkol anumerta, ucap Fajar. Letkol Luluk diketahui meninggalkan seorang istri dan dua orang anak. Ia mengalami kecelakaan ketika sedang melakukan misi latihan rutin bersama salah seorang murid penerbang TNI AU. Latihan normal, tergelincir keluar dari runway. Nggak jatuh, tergelincir ke luar #detikcom #lightroommgetan - @lightroom.magetan_ on Instagram

doesnt need this to go viral aakash mehta no need to be famous no need to trend not asking for more

Follow me if you’re from explore: @21sseed Collab with @uzisbelt • • • • #llj #playboicarti #wlr #foreigner #funnymemes #memes #dailymemes #wholelottared #explore #viral #views #lol #lmao #dankmemes #memesdaily #haha #comedy #twittermemes #instagram #instagrammemes #explore #funny #explorepage #comedy #offensivememes #wholesomememes #llx #funnyvideos #funnymemes #worldstar #liluzivert - @21sseed on Instagram

memes

Collab wit @stonedpatrick_ • • • • #bushdid911whichcausedthecivilwarwhichmadekanyewestsaygeorgebushhatesblackpeople #obunga #explorepage #explore #bhfyp #woowednesday #georgefloyd #hoodhumor #hoodratchetness #memetangclan #funnyfights #schoolfight #hoodfight #niggamemes #flightreacts #hoodlaughs #imdeadaf #wildmemes #thiccanimenigga #laughfactory #funnyfights #schoolfight #hoodfight #niggamemes #funnyhoodvids #hoodlaughs #imdeadaf #wildmemes - @godsdick on Instagram

uks unbreakable unbreakablekimmyschmitd kimmy schmitd viral

- Quick get me to 10,000 karma

innervoice media ivm film audio

Sweden is burning Theyre burning Sweden because someone burnt a copy of Quran Its looks like same what they had did in bangalore -burning vehicles -destroying property -fighting with police And all Follow @voice_of_hindutva Use my hastagat #voiceofhindutva #Hindus #HinduUnitedAgainstTerror #hinduism #Hindutva #Modi #modi #yogi #YogiAdityanath #trending #trendingnow #trendingtopic #Indian #hindutemple - @voice_of_hindutva on Instagram

bitrix24 bitrix24fun 2020 covid covid19

Baru saja terjadi kecelakaan di dekat Samsat Sragen lur.. Truk VS Truk, truk satunya kabur melarikan diri. Supir & kenek truk muatan hebel mengalami luka-luka. . Yang mau melintas mohon hati-hati yaa, saat ini di TKP sedang proses evakuasi krndaraan.. . FOLLOW! akun kita dan aktifkan notifikasi untuk mendapatkan infomasi terbaru seputar KOTA SRAGEN ====👇🏻👇🏻👇🏻==== @sragentrending @sragentrending @sragentrending =============== #sragen #sragentrending #sragenhits #sragenkita #sragenwalker #sragenasri #sragenhitz #sragenkota #sragenfans #sragenunited #sragentina #sragenhijab #sragenselfie #kulinersragen #sragenkonveksi #sragenfoodies #sragenvaper #sragenolshop #promosragen #diskonsragen #sragenlove #sragenkosmetik #sragenkeren #sragenkekinian #sragenjualan #sragenfood #kulinersragen #lokersragen - @sragentrending on Instagram

project sekai

Sabtu (26/9) #LalinMalam Terjadi kecelakaan di kawasan Jl Sunset Road seberang Carefour. Harap berhati-hati bagi yang akan melintas di kawasan tersebut. Info dari @veranska @agungdewii @widhi.maharta via @infodenpasar #infobali_update #infobali #bali - @infobali_update on Instagram

send this to the press send it to the news put it on the news put in the newspaper make go viral

I don’t even know what to put as tags for this - @playboialexxan on Instagram

agenturleben agencylife hannover kochstrasse kstr

INDUCTION FOR THE 2019/2020 SESSION HAS OFFICIALLY KICKED OFF!!! What was memorable to you during your induction training? #olympus #unilaginduction #casaunilag #casalifestyle - @casa_lifestyle on Instagram

one of those clips ended up going viral avori one of the videos ended up gaining a lot of traction one of the footage ended up gaining a lot of popularity xset

Serikat Buruh masih memilih untuk bertahan didepan gedung DPR... Sampai diterima suara mereka oleh wakil rakyat! TOLAK OMNIBUSLAW! ________________ PANJANG UMUR PERJUANGAN! 🔥#viralkan___bantu_share #diamataumelawan .. ✔️𝒇𝒐𝒍𝒍𝒐𝒘 @apri.725 ⚠️𝑲𝒐𝒍𝒐𝒎 𝒌𝒐𝒎𝒆𝒏𝒕𝒂𝒓 𝒌𝒉𝒖𝒔𝒖𝒔 𝒇𝒐𝒍𝒍𝒐𝒘𝒆𝒓𝒔 . #apri725 #Jackpotsquad #YukNgaji #pemudahijrah #sholawat #palestinamerdeka #maiyah #ketikaazazilberputusasa #fuadbakh #Santri #kamioposisi #bubarkanpdip #dakwahislam #pemudahijrah #opposite6890 #pecintaustadzabdulsomad #vidiodakwah #saveruslanbuton #ganyangPKI #tolakruuhip #apriptr #hadifayyadh #bencana2020 - @apri.725 on Instagram

wfh work from home working from home stay at home virus

Finally, all four charged. 👮🏻‍♂️👮🏻‍♂️👮🏻‍♂️👮🏻‍♂️ one step closer. Be heard, demand justice. 🖤 #justiceforgeorgefloyd #blacklivesmatter #blm #georgefloyd - @ricksilver on Instagram

that thing you did its not going viral michael bryce ryan reynolds hitmans wifes bodyguard not going viral

Abolish ICE protest: Sunday, September 27th 12pm Washington Square Park. See you there. - @skeezix10 on Instagram

alina sanchez gif art mirrow medusa meme

excited to finally have this small body of work out via @bengomoris monologues records based in london. in 2018 i worked with @shakesdollasign, @decaf.steve and @salayisaidso on some experimental kwaito/house/acid vibes and this is what came out. so far we’ve had support from @laurent_garnier, @ame_innervisions, @solomun, @jaquesrenault, nemone (BBC radio 6), @laurenflax, @horse_meat_disco and more which is super dope. our studio in woodstock at the time was consistently filled with plastic smoke bc the methheads used to burn stolen wire outside to sell the copper around the corner. meet the humble souls in these photos. anyway, full tracks are on spotify etc etc tracklist: maxime alexander - bsa freestyle #1 (feat. shakes) maxime alexander - dress the part (feat. shakes) maxime alexander - bag (feat. decaf, salayi, shakes) (special thanks to @posthumanmusic for making this release possible) xx dan - @daniellidchi on Instagram

make this shit go viral bitch andrew callaghan all gas no brakes trending famous

If you dont follow @streetridersnyc, you need to. Youve probably seen, or were apart of, their Justice Rides throughout NYC. Last month, the Justice Rides brigade, along with volunteers, met up to clean the neighborhood and streets, covering about 15 blocks around the Bedstuy/Bushwick boundary. Now, that is what community looks like. 👏🏾 Stay up to date as they schedule more community cleanups and Justice Rides throughout BK and beyond. 🙌🏾🙏🏾✊🏿✊🏿 - @bk_reader on Instagram

sportsmanias emoji animated emojis social distance social distancing

- hmmm

fastest hotdog eater hot dog shooter eater we gone viral with this

Dimanakah Letak keadilan ? . @ultras.terraces @ultras.terraces . #ultrashooliganid - @ultrashooligan.id on Instagram

wriggle it sick day flu cold google

- Do you remember Hong Kong Police attacked Hong Kong Universities in 2019? NEVER FORGET AND NEVER FORGIVE POLICE BRUTALITY!!! We must not give up until achieving our 5 demands.

this goes hard this is viral viral tutankhamun pharaoh

1-oct (barcelona) 2020 👮🏻‍♂️🐷 #graffitiporn#graffitiart#fullhd#graffiti#barcelonagraffsquad#hd#bcn#train#subway#metro#acab#acab1312 - @barcelonagraffsquad on Instagram

emma mod mod emma

HILANGNYA HURUF R ITU. Dalam acara ILC semalam, ada sebuah insiden kecil: Tiba-tiba huruf R dalam pesan BEBASKAN JRX di masker saya, hilang. Pesan khusus di masker itu memang tempelan. Saya sendiri yang membuat huruf-hurufnya dari kain bekas kaos dalam. Saya lapisi bagian belakangnya dengan double tape alias selotape bolak-balik. Saya mengerjakannya sendiri beberapa saat sebelum berangkat ke ILC. Waktu tak cukup untuk menguatkannya dengan jahitan. Maka terjadilah insiden itu. Masker ini sangat tipis. Saya gunakan memang hanya untuk display pesan yang ingin saya sampaikan. Hanya saya pakai saat berbicara. Rupanya, hembusan angin dari mulut saat saya bicara membuat huruf R nya terkelupas dan jatuh. Begitulah cerita yang amat sangat tidak penting yang ingin saya bagikan. Cerita pentingnya: Sebagai warga negara kita selayaknya jadi para penjaga Konstitusi yang antara lain menjamin kebebasan berbicara. Kita wajib memperjuangkan kebebasan berbicara sebagai hak konstitusional kita. 🙏🏼 #bebaskanjrxsid #sayabersamajrx - @eepsfatah on Instagram

2020 viral trend virus mask

Pakkakelli Adukomma😂😂 Bigg brother ante English Bigg Boss Anamata . . . . . #bb4 #nagarjuna #starmaa #MonalGajjar #monal #sohel #noel #akhil #mehaboobdilse #ammarajasekhar #divi #devi #sujatha #avinash #abhijeeth #lasya #gangaavva @ariyanaglory #AriyanaGlory @actordivi @syedsohelryan_official @abijeet11 @monal_gajjar @akhilsarthak_official #AkhilSarthak Follow @biggboss4_ for more updates #biggbossTelugu4 #biggboss4telugu #Biggboss #Starmaa #biggboss4_ #KingNagarjuna #AkkineniNagarjuna #RealityShow #WhatAWowWow #Bringbackdevinagavalli Follow @biggboss4_ Follow @biggboss4_ Follow @biggboss4_ Follow @biggboss4_ Follow @biggboss4_ Follow @biggboss4_ Follow @biggboss4_ Follow @biggboss4_ Follow @biggboss4_ Follow @biggboss4_ Follow @biggboss4_ Follow @biggboss4_ - @biggboss4_ on Instagram

antenna edit 70milliseconds

Disponible sur YouTube #XalaatTV #SaXelMooySaKoom - @xalaattv_1 on Instagram

the thundermans the videos gone viral phoebe thunderman viral video kira kosarin

#prayforlebanon - @abdinegaraindonesia_ on Instagram

stay safe corona coronavirus covid covid19

- I stand on these bitches 💯💯💯

viral so you wanna go viral

Tengok kanan tengok kiri... Isine wong pacaran... 😒😒😑 . . . #sragen #patroli #alunalunsragen #kridoanggosragen #sabhara #polri #polisijateng #poldajateng - @harry_praztya on Instagram

pero creatures of sonaria cos pixel art

Local street food 🔥 always beats burgers - @kulinerjogja on Instagram

your happy workplace wendy conrad the world is talking about it everyone is talking about it rumors

Black People can’t Do Nun 🤦🏽‍♂️😂😂😂‼️ #Twohunnid #Djnate #Djnateakabakaman #Upnext #trendingnow #Newmusic #Worldstar #Spotify #Upcomingartist #Soundcloud #Photooftheday #Chicago #Newyork #Drill #Juke #Rnb #Producer #La #Texas #Flexxbabii #Viral #Promoter #Fbe #Uk #Footwork #Musicartist #music industry #Hiphop #Xxlmagazine #atlanta - @djnateakabakaman on Instagram

that is sad and also tragic ron rons gone wrong thats so depressing thats very sad

Alhamdulillah kegiatan hari ini bisa sedikit berbagi dan berkunjung kepada para simbah yang luar biasa. Bisa nyepeda juga bareng temen-temen Sale 😊 - @masbayurembang on Instagram

it went viral trending viral popular liked

Uddhav chacha reflected balasaheb thakre today . . . . . . . . ➖➖➖➖➖➖➖➖➖➖➖➖➖➖ #nagpur #nagpurfoodies #nagpuritadka #nagpurians #nagpurshitposting #nagpurphotography#tarripoha #nagpurdiaries #nagpurian #nagpurimemes #nagpurmemes #Nagpur#bombay #mumbai #delhi #bhandara #gondia #vidharbha #yavatmal #chandrapur #gadchiroli #poha #kamthi #memes #ycce #rcoem #sbjain #raisoni #pccoe ➖➖➖➖➖➖➖➖➖➖➖➖➖➖ - @nagpurshitposting on Instagram

kks kathkirchestmk katholischekirchesteiermark takeover instagram

Berani berbuat, berani bertanggungjawab 🙏🙏🙏 ! Pelajaran bagi kita semua apabila kita memang benar2 terbukti melanggar peraturan...akui kesalahan kita...jangan melanggar lagi...jangan melawan petugas...minta maaf...dan terima semua tindakan yg diberikan petugas untuk kebaikan kita juga di kemudian hari 🙏🙏🙏. . @jejakselebriti @airnations @yamacarlos_btv @kurniawanbony @barberbarid @pamanmimin @zulfikar_faisal0404 . #yamacarlos #babamarco #airnations #jejakselebriti #satpolpp #polri #tni #komando #psbb #covid_19 #corona #sehat #olahraga #masker #jagajarak #pushup #tertib #patuh #tanggungjawab #ikhlas #tanpaperlawanan #senanghati #pujituhan - @yamacarlos7 on Instagram

im going viral no way donald trump jeff bergman our cartoon president goes viral

#herewegoagain :. What kind of #world & #country are we living in where another unarmed #africanamerican man had to beg for his life, be subjected to such horrific, inhumane treatment and met his fate at the hands/knee of a cowardly, racist, remorseless and poor excuse of a so-called “police officer” whilst the other thug officers watched with no intervention whatsoever. Makes my blood boil. This murderer should pay with his life and nothing less 🤦🏻‍♂️🤦🏾‍♂️🤦🏿‍♂️😔🤯🤬☝🏽👊🏾⚡️.: George Floyd, a 46-year-old African-American man, died after being handcuffed and pinned to the ground by a police officer’s knee on Monday, May 25. The Minneapolis police officers were called after a grocery store clerk accused Floyd of forgery. Officers pinned Floyd down and an officer pressed on his neck with his knee and although Floyd repeatedly said, “I can’t breathe,” the officer did not remove his knee. After several minutes of being held down, Floyd became unconscious. Medics arrived and Floyd was later pronounced dead on Monday at 9:25 P.M | Source NY Times . . The scrupulous demand justice for Floyd, his family and for our community. Rest in Power #GeorgeFloyd #justiceforfloyd #fuckthat #disgusting #seethedisparity #unecessaryforce #changeisneeded #reform #transformation #police #departments #nationally #policebrutality #wheresthejustice #pandemic #racism #thisisamerica #letthatsinkin #blacklivesmatter - @wf_rg on Instagram

wfh work from home working from home stay at home virus

#BantuShare Indonesia sudah merdeka 75th yang lalu, hari ini pula memperingati hari #KesaktianPancasila, tapi masih banyak segmen masyarakat yang belum merasakan apa yang disebutkan dalam sila ke-5. . Untuk yang ingin pijat, silahkan hubungi Pak Wan 081237896813 tinggal di daerah Br. Petingan Kerobokan & juga mungkin bisa membantu . #semetonpds Info dari @jesichayu #infopadangsambian #Bali #BersamaMembantuSesama #Merdeka🇲🇨 #DenpasarKota - @semetonpds on Instagram

aunty donna looking for cowdoy instead of promoting our netflix show cowdoy in the city viral santa

10k Toys for Watts!!! . Beyonnnnd grateful to all who made this day possible for the kids! . Especially love my momma for flying in to celebrate this day in Watts (also my BDay)! . Special Shout Out for Toys & Swag to: . @beyonce JayZ @kyliejenner @kendalljenner @krisjenner @kourtneykardash @khloekardashian @kimkardashian @logic @alexisren @childishgambino @feliciathegoat @lildickygram @chrisbrownofficial @meganhenderson @t.snell_ @cottonhoodapparel @saltandstraw @phatmojo Imperial Toys @jakkstoys and @loganpaul for bringing snow to Watts! . If you want to support, buy our clothing line Watts2250.com or youthmentor.org/donate . 🎥💯: SavMears 🎥💯: ChrisQuilala 📸🔥: PeteyKStyles 📸🔥: BrennenMcMurray . Comments are now OFF. I want to say straight up how grateful I am to many of my friends who donated of toys + swag + their time to make this day possible. Instead of the haters turning me off, you are simply fueling me... to stand up EVEN MORE for those who are often misunderstood, regardless of someones socio-economic status... our whole Watts Family knows what it feels like to be misunderstood. We will not sway in our resolve. . The Watts Empowerment Center will continue to be a safe place for ALL of us to connect... not as society has labeled us, but simply as humans. - @redeyeinc on Instagram

covid covid19 corona corona virus frontline workers

- Blursed truck

make a dance video on tiktok ben rider viralhog quarantingle dancing

Hiatus lah:v Ampe mood ngedit xixi - @lsrumii on Instagram

virus fox back off go away

Oh, His Grace. Make way for His Divinity. Safari services starting soon. Dm for bookings #lansdowne #elephants #tuskers #tusker #elephant #wildanimals #naturephotography #lansdownecorbettdivers #corbett #jimcorbett #animals #safari #videooftheday #video #elephantlove #naturelovers #instago - @lansdownecorbettdivers on Instagram

its going viral miniklin its spreading fast its trending its shared widely

Roller APS Iniciante! Todas as Quartas, a partir das 19:00hrs, saindo do Marco Zero!!! É Obrigatório o uso do Capacete!!! #apsinline #arenainline #oxenteinline #suicidasdapista #marciopaixao20 #paulao327 @team_crazyinrollers @livingskateshop - @apsinline on Instagram

covid social media truth covid19 conspiracy

Rakyat di perlakukan beda dengan yang mau PIL-KADA, apakah ini keadilan sosial bagi seluruh rakyat indonesia ? Mana ni yg suka edukasi2 komen dong kleng !!! Jangan lupa goyang dulu ya #mengungkapfakta #pilkadajalanterusyanglaindilarang #PILkadaobatCOVID19 #PILkadaSakti #bebasberpendapat #BebaskanJRXSID #JRXSIDtidakbersalah #KamiBersamaJRXSID #kuatkitabersinar #nyalakantandabahaya 🛠©️ Semua hak dan kredit dimiliki oleh masing-masing pemilik konten🛠⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⚡️Apabila ada pelanggaran konten atau pelanggaran hak cipta yang dimaksudkan, mohon DM untuk setiap permintaan atau penghapusan⚡️ - @jrx_meme on Instagram

the story is going to be viral chris rock viral story getting viral good story

Please help me wish this man a happy birthday...my blooodest bloood.. My biggest motivation the man who helped me discover my talent @izzy_mawu.. Live long broo.. I am grateful for your support I love u soo much king.. God bless u any day all day ❤️❤️❤️.. More shelling congoooo - @donitchiofficial on Instagram

linz linznews news nachrichten stadt

SEKOLAH❌ SEPAK BOLA ❌ PILKADA✅ . . . _____________________________ #aktivis #mahasiswa #matanajwa #quotes #haritaninasional #NKRI #pahlawan #munir #wijithukul #marsinah #tolakomnibuslaw #corona #covid19 #bungkarno #novelbaswedan #pmii #imm #hmi #septemberhitam #16tahunmunir From @suporter.community - @suara_aktivis on Instagram

viral memes tyra banks good housekeeping popular memes meme

- @faisalabadi.memes on Instagram

witness look conscious watched watch

😬 . Join us - @hasi_to_fasii . . . #indian #india #love #instagram #photography #mumbai #follow #instagood #fashion #bollywood #like #delhi #photooftheday #likeforlikes #bhfyp #indianwedding #kerala #indianarmy #indianfood #art #followforfollowback #style #model #funnyshit #beautiful #memes #food #maharashtra #desi #hasi_to_fasii - @hasi_to_fasii on Instagram

that shit went viral viral viral video excited lindsay lohans beach club

Ген. директор «зайцев.нет» устроил ДТП в Москве на своём роскошном спорткаре🤬 Есть пострадавшие.. Как думаете по какой причине произошла авария?🤔👇🏼 ——————————————————— ✔️Follow us: 📍@majorka__777_ - основа 📍@majorka_market - атрибутика 📍@majorka_concept - аксессуары 📍@majorka_autoboutique - автозапчасти ——————————————————— 👥Tag your friends - @majorka__777_ on Instagram

kim x aubrey aubrey x kim cotton candy omori omori kim

Oh No... ~ #meme #dank #dankememes #hati2diinternet #dankmemeindo #memeindonesia #memelucu #memelucuindonesia #wibu #wibuindonesia #memelokal #shitpost #dankmemes #dagelan #dagelanlucu #dagelanlucubanget #video #videolucu #vrindavan #internetpositif #internetnegatif #memes #memes😂 #xd - @zans.exe_ on Instagram

this is for sure gonna go viral talia jackson jade mckellan family reunion viral video

Yamaha or Honda?🔥 Love Super Bikes? Follow👉 @sport.bikes.club Follow👉 @RidePull @yummy_r1 @afsaromer @bilal.solakoglu - @sport.bikes.club on Instagram

pat pat pet pet meme patting petting

BOSEN PESMABA MANA SEMPAT KEBURU NYANYI BARENG DOSEN (Abaikan suara aing :) ) #1prinsip1fisip #pesmabaumm2020 #pesmabafisipumm2020 #bemfisipumm #sefaisip - @_nava28 on Instagram

viral nianation nos niadennis arewegoingviral

PORTLAND: an irate small handicapped protester in a wheelchair is pushed back by police after refusing to stay on the sidewalk Protesters seemed to think he deserved special treatment because he is disabled Portland police treated him equally to abled people as required by law Portland PD are not ableists and refuse to discriminate against the disabled I’m very happy to see that they treat people in wheelchairs the same as those who do not use them This is the kind of equal treatment we are fighting for in a progressive city No ableism here - @officialslightlyoffensive on Instagram

gelo ngakak kumis viral hemmm

**Graphic Educational Content!** Inside an emergency department after the blast earlier today in Beirut, Lebanon. It is clear to see why the hospitals were turning patients away. The video reminds us why we need robust triage protocols - so lets touch on the basics of START Triage. MASS CASUALTY TRIAGE: TRIAGE is from the French derived word Trier aka to sort out. Goal is to achieve the maximum good for the maximum number of patients in a controlled manner. START triage algorithms: (Simple Triaging And Rapid Treatment) Components include 1. RESPIRATIONS 2. PERFUSION 3. MENTAL STATUS CATEGORIES: EXPECTENT (BLACK)-- unlikely to survive d/t injury severity and resources of care needed. Palliative approach and pain relief provided. Separate from group but mitigate dying alone IMMEDIATE (RED)-- helped w/ rapid intervention and transport. Needs medical impact 60min for survival. Mainstay is MARCH algorithm compromise DELAYED (YELLOW)-- transport can be delayed. Includes serious and potential life-threat injuries, BUT status not expected to decline or deteriorate over several hours MINIMAL/MINOR (GREEN)-- walking wounded, relatively minor injuries. Status likely to remain over several days. Should be able to assist in own care. There is typically a triage officer and med control for large events, HOWEVER, mass casualties could happen anywhere and depending on the resources 2-3patients could be considered a mass casualty and these principles still apply. Google: Start triage to learn more. Most wording above from @the_resuscitationist. Be safe and stay vigilant. #beirut #lebanon #bomb #explosion - @wildernessdoctor on Instagram

oh honey youre about to go viral viral celebrity oh honey youre about to go viral

💪🏻 - @realgoldgad on Instagram

texas go vote texas texas voter vote in texas tx

Kehabisan bensin adalah jalan ninja kami “Panjang umur persaudaraan” #naikvespayuk #vespa #vespaindonesia - @naikvespayuk on Instagram

make it viral green dumpling go viral popular trending

Mit ca. 4/5 Jahren bin ich das erste mal aktiv mit Rassismus in Kontakt gekommen. Es hat mich damals genauso getroffen wie heute und war genauso unbegreiflich. Doch da ich zu dem Zeitpunkt noch nicht so viel über diese Welt wusste bin ich davon ausgegangen dass sich dieses Problem irgendwann von alleine löst. Ich hatte/habe so viele Freunde aus allen möglichen Teilen der Welt und konnte mir einfach nicht vorstellen dass wir uns wenn wir mal erwachsen sind Aufgrund unserer Herkunft ernsthaft diskriminieren. Naja, man wird erwachsen... Mittlerweile leben wir in einer Welt in der sowas wie die Geschichte in dem Video gestern, in ein paar Wochen leider schon wieder vergessen wird. Wer denkt das im Jahr 2020 Rassismus kein Thema mehr ist lebt in einer Blase oder ist noch nie ernsthaft damit in Kontakt gekommen. Ich bin grade in einem Alter in dem viele meiner Freunde Kinder haben die bald in das selbe Alter kommen das ich damals hatte und die Vorstellung dass sie in 20/25 Jahren die selbe traurige Erkenntnis haben, weil immer noch Menschen sterben müssen weil Sie anders aussehen, macht mich unfassbar traurig und wütend... Lasst uns weiter dagegen ankämpfen dass diese Vorstellung nicht zur Realität wird. Egal wie lang es dauert und wie schmerzhaft es wird. Wir sind alle gleich. - @stzy24 on Instagram

tik tok tiktok animation tiktoons abnormal chaos tiktok dance

- Its a free country

so viral shea whitney so famous trending popular

- Yeah I’m just your average 9yo girl

lets get vaccinated get vaccinated vaccination dancing vaccine covid vaccine

Ibu yang Dibacoki Anaknya Akhirnya Tutup Usia . Muripah, 65, seorang ibu yang sebelumnya dibacok anaknya Adi Murdiyanto Hermanto, 27, Sabtu (26/9) malam akhirnya tewas. Ibu lansia tiga anak warga Dusun Kuripan, Desa Jumeneng, Kecamatan Mojoanyar, Kabupaten Mojokerto ini meregang nyawa di tengah menjalani perawatan di RSUD dr Wahidin Sudiro Husodo, Kota Mojokerto Rabu (30/9). Iya betul meninggal, ungkap Yasin, salah satu tetangganya. Menurutnya, korban dinyatakan meninggal di rumah sakit plat merah itu sekitar pukul 18.30 WIB. Tapi, habis insya sekitar pukul 19.30, baru diumumkan di toa musalah, tambahnya. Repost @radar_mojokerto #infoseputartrawas #trawashits #trawasmojokerto #trawas - @infoseputartrawas on Instagram

youve gone viral youre viral your famous youre trending debby ryan

The infamous dudes of towers parking lot was at it again last night - @nsuspartan_spam on Instagram

angry top war battle game mad furious enraged

Two of the most famous people from my hometown are James Chaney, the civil rights worker murdered by the KKK during Freedom Summer, and Fred Phelps, the founder of the Westboro Baptist Church. My hometown had a march in support of BLM, and it makes me happy to see. - @lauramckittrell on Instagram

its gone viral its trending viral popular trending

tag temen lo yang malu maluin 🤣 . . cr: tiktok//etikahandyn - @colorteutic on Instagram

ogi ogi logo

Jl.A.Yani 2 / pemuda - @berita_samarinda_official on Instagram

you just created the biggest viral moment canadas got talent you will be famous you are getting fame this will go viral

- Police brutality has never ceased

%E3%82%AB%E3%83%83%E3%82%B3%E3%81%A4%E3%81%91 %E3%83%99%E3%82%BF%E3%83%83%E3%82%AF%E3%83%9E betakkuma %E3%81%8A%E5%87%BA%E3%81%8B%E3%81%91 %E8%A1%8C%E3%81%A3%E3%81%A6%E3%81%8D%E3%81%BE%E3%81%99

KAMI LAPORKAN TKP GANTUNG DIRI DI JL PRONA 2 GANG 1 DEKAT PRONA 1 SEPINGGAN BPP SELATAN. tanggal 1 Oktober 2020 diunggah jam 09.45. hingga berita ini diunggah masih dalam lidik polisi . Repost : @info_bencana_balikpapan - @balikpapances on Instagram

that went viral as the flu mariska hargitay olivia benson law and order special victims unit popular

Go and watch the epic doc we shot in Argentina over the last month. Shout out @elizepequeno @martino_tifo @ialbapi @joshostafford @aleccutter @agustinbelachur @copa90 ✊ - @johnnieford on Instagram

h%C3%AD hello wave smile cute

What a morning! Our unit #6060 has been keeping busy today....and yes, wet too 😅 in order to perform the contracted work at the Marcon job site on Saint George Street @cityofpomo this morning. Kudos to our team for being hands on and determined to making this work. They literally had to remove fences, a portable washing station, portable washrooms and adding pads onto the road in order to drive to the crane set up spot. Phew 😅 It worked beautifully thanks to great driving skills and a very helpful signal man. #cranerental #cranelife #cranespotting in #portmoody #bc #mobile #crane #hoisting #2500 #lbs #pallets #local #newbuild - @phoenixtruckcrane on Instagram

stickergiant viral influencer go viral popular

Hier drücken 3 Polizisten eine Frau zu Boden, nebenbei schlägt ihr ein anderer Polizist brutal auf denn Nacken! Nähere Infos zu dem Fall auf dem 2ten Bild - @corona_rebellen_berlin on Instagram

i got the vaccine i got vaccinated vaccinated get vaccinated covid19

Real life, I once bought 20 packages of tofu because they were half off and theyre literally never on sale. 🍋🥑 #whatveganseat #ketovegan #veganprotein  #vegan #veganism #veganfood  #veganbodybuilding  #paleovegan #atxvegan #veganmeme #veganmemes  #veganpizza #veganicecream #vegandinner #veganfitness #veganfitspo #vegans #veganbreakfast #veganoptions #veganfastfood  #vegancommunity  #veganmeat  #plantbased #plantbaseddiet #tofu #vegantofu #bakedtofu #tofuteriyaki #tofuscramble #vegantacos - @frugalvegan on Instagram

godzilla vs kong bernie hayes yeah going viral viral going viral

Siap Mas Gub @ganjar_pranowo -- Laksanakan.. - @hendrarprihadi on Instagram

happy funny party meme cool

Meme slide 😹🙀 Follow @saltyvro Follow @saltyvro Follow @saltyvro - @saltyvro on Instagram

tim minchin viral housefyre music video

These the same niggas who flush the toilet once a week to “save bills” - @jidrip_ on Instagram

imvaccinated vaccinated get vaccinated vaccine covid vaccine

😆 check out the link in @realshona99 ‘s bio 🔥🔥. Meme by @qmpaso_ - @zimbabweans_be_like on Instagram

youtube famous internet famous sensation youtube viral big deal

Polsek kec pakuhaji bekerjasama dengan pmi kec pakuhaji kepada para pengguna jalan untuk slalu memakai masker. Guna mencegah penularan virus corona - @pakuhaji_info on Instagram

covid_19 coronavirus epidemic virus

- I 🅱️ Staying Winning

do you remember the nyc pizza rat that went viral simon law %26 order organized crime do you recall the famous nyc pizza rat do you recall the viral video of the nyc pizza rat

Sizcede öyle değilmi 😄 - @mukemmellezzetler on Instagram

instagram live twitter social media selfie

Ну, здравствуйте, осенние дождики😬💦 Видео @katerina__pashina #typicalnvrsk #новороссийск - @typical_nvrsk on Instagram

its gone viral chicago pd viral it has spread going viral

- To serve and to protect

kkool kkona twitch emote

mal too sad mal too sad mal too sad mal too sad mal too sad mal too sad mal too sad mal too sad mal too sad mal too sa dmal too sad mal too sad mal too sad mal too sad mal too sad mal too sad mal too sad 😞 . . follow @vestjet for more vids . . #darkhumor #cancerousmemesforautisticteens #autisticmemesforautisticteens #dankmemesdaily #jetfuelcantmeltsteelbeams #cancerousmemes #sledgang #topkek #niggermemes #dankdank #bepis #nword #epicgamer #redditmemes #gore #gorememes #messedupmemes #anime #weeb #doggo #inspirational #wholesomememes #wholesome - @vestjet on Instagram

it went viral famous popular it blew up jax taylor

- Dont know if this belongs here , people have just started rioting and stealing in my country. Nothing better that start taking videos of all the food youve just stolen am I right?

ecomity emoticon emotional gifs okay no pro

- Headline News

im viral will davis miles teller get a job viral video

GRPD Chief Eric Payne kneels with protesters for Breonna Taylor. - @fox17online on Instagram

dinosaur cute animal green get out

First we want to thank everyone who reached out to us over the last few days to check on us the outpouring of love and support from everyone has been amazing. Thank you again to all the volunteers who came out Sunday with brooms and cleaning supplies to help with the clean up efforts for everyone on the block. For those that don’t know our store is one of the many that we’re looted on Saturday on the Fairfax block. Our shop has been on Fairfax for the last 4 years but Fairfax has been home for many of us for over 10 years. We are saddened by what has happened to our shop and the rest of our family on the block. If looting our store will in anyway help get more attention to the actual cause at hand we are willing to sacrifice our store to help bring around much needed change. The real anger we have is with the continued killing of innocent black people in America at the hands of law enforcement the years of systemic racism and the unfair treatment of all POC that has continued to plague America. All of us here at the store stand strong in solidarity with the black community and all the people protesting and fighting for justice and change that needs to finally happen in America we hear you and support you. Our store can be rebuilt our inventory can be replaced and we can come back from this stronger than ever however George Floyd’s life and all the other lives that have been lost before him can’t be brought back or replaced. For that we must continue the fight for change and equality amongst all. Now is not the time to be silent our voices must be heard. Black lives matter today yesterday and forever. - @exhibita.la on Instagram

it would go viral anthony vincent ten second songs trending trendy

For some reason the NYPD does not tolerate ICE protest 🤔 We can not let them violate us from our right to protest!!! We will be at Washington Square Park tomorrow at noon! We need everyones support, please bring signs, wear masks, and wear all black! 🎥:@skeezix10 TYSM!!♡ #abolishice #abolishpolice #immigrantrightsarehumanrights #nycprotest #nohumanisillegal #blacklivesmatter #blm #abolishdhs #stolenland - @gracef7 on Instagram

professor hypnospace bonzibuddy 1999

Welcome to the club. 📸 @dannyda2v #ford#2v#3v#4#gt#mustang#lmr#americanmuscle#newedge#dfw#make2vgreatagain#1320video#newedgeworld#photoshoot#racing#dragracing l - @asianpersuasion2v on Instagram

300

Hari ini 20 September 2020✨ WishUsLuck! . . . . #grandopeningkyafe #enjoykyafe #newplacenewhopenewnormal #wishusluck - @kyafe.co_ on Instagram

atra bilis music sticker stickers stickers for whatsapp

Mercenaire x Mata - 97 Gang Prod By @djken972 📽 @gislandsfilmz En Ligne Sur Youtube 💯😎 - @mercenaire_aby on Instagram

it went viral trish stratus canadas got talent it was trending it became popular

Bulati hai magar😜😜 - @sujalsingh182 on Instagram

On Wednesday, Sept. 9 at 11:38 a.m., #MDFR received a call of a traffic accident in the area of SW 147 Ave. & SW 80 St. Upon arrival, units found a white vehicle that had struck a tree with one patient trapped. A total of three MDFR units worked diligently and were able to extricate the patient within 15 minutes of arrival. #Rescue57 transported one trauma alert patient to the hospital for further treatment. The cause of the accident is unknown. - @miamidadefirerescue on Instagram

- cursed_flood

- Kamal

- I sure love chatting to friends and family about the environment

- @nadavidisigalingging on Instagram

Pelaku penipuan dgn korban ibu-ibu yg viral di medsos dgn modus Hipnotis (gendam) berhasil ditangkap... Dari keterangan korban,pelaku saat itu mengajak bicara dgn korban dan menepuk2 bahu korban,lalu pelaku menyuruh korban untuk mengumpulkan semua uang untuk diserahkan kepada pelaku,kemudian korban ditinggal diwarung minum. Pelaku diamankan disebuah kost2an di jln kemiri,kec.banjarmasin timur. Selanjutnya pelaku beserta barang bukti dibawa ke Polsek Banjarmasin timur guna dilakukan Proses Hukum lebih lanjut. Pelaku dijerat dengan Pasal 378 KUHP,diancam karena penipuan dengan pidana penjara paling lama empat tahun. via @kabar_banua_kalsel - @viral_berita on Instagram

Engineer students😂😂 . . . . . . . . #onlineclasses #studentlife #school #collegelife #hostellife #lockdown #lockdown2020 #coronamemes #life #loveyourself #india #earth #world # - @memesbazaar2.0 on Instagram

कोरोना व्हायरस मुळे निर्माण झालेल्या अडचणी मुळे माणुसकीच्या नात्याने गरीब लोकांना गुरुजी तालीम मंडळा तर्फे दररोज अन्नदान करण्यात येत आहे. - @guruji_talim_mandal on Instagram

remember the days my homie and i made the spanish teacher so mad she wanted to quit 💯🐐 - @yafty.exe on Instagram

- how is this possible.

Υπάρχουν κανόνες σεβασμού μεταξύ των πολιτών στον πολιτισμένο κόσμο. Για παράδειγμα οι πεζοί να περπατάνε στον πεζόδρομο και όχι στον ποδηλατόδρομο. Σε αντίθετη περίπτωση μπορεί να επέλθει μέχρι και θανατηφόρος τραυματισμός με αιτία τη χοντρόκεφαλιά μας. Π. Χ. Όταν μια κούρσα ποδήλατο που τρέχει με περίπου 50 km/h πάρει ζβάάάρα εσένα ή το παιδί σου Θα είναι σαν να πέφτεις από τον 3ο όροφο πολυκατοικίας. Και θα φταις εσύ. Και θα τον πληρώσεις τον ποδηλάτη αν ζήσει εσύ. Εκτός από το παιδί σου... Οπότε ας περπατήσουμε εκεί που είναι για πεζούς και ας ποδηλάτησουμε εκεί που είναι για ποδήλατα. Και ας τρέξουμε εκεί που είναι για πεζούς. Γιατί ένας δρομέας που κάνει γύρο λίμνης πάει σαν κότα μπροστά σε έναν ποδηλάτη. Για γονείς που αμολανε τα παιδιά στον δρόμο επειδή είδαν στον ύπνο τους ότι είναι παιδική χαρά δεν μιλάμε. Οι ποδηλάτες. Δεν παίζετε σε ερωτική ταινία να πιάνετε χέρι χερι 2 ποδήλατα. Κλείνετε όλο τον δρόμο. Θα κόψετε κανέναν άνθρωπα. Πάτε ο ένας πίσω από τον άλλο αν είστε πολλοί. Μη πάτε με το ποδήλατο σαν μπανταλοί πάνω στο πεζοδρόμιο (εκτός εάν είναι να αποφύγετε τον θάνατο σας από χοντροκέφαλο). Ελπίζω να βοήθησα. Σε λίγο θα χρειαζόμαστε και δίπλωμα για να περπατήσουμε... Ξεκινάει η περίοδος που η λίμνη γεμίζει ποδηλάτες. Ας μην μινει κανένας μας τετραπληγικός ή παραπληγικός σε καροτσάκι. Μακάρι. - @ioanninacityguide on Instagram

- @mtstroll on Instagram

Dorothy Reborn 😈🔥 @10fintectuningsolutions @elantra.avante.hyundai @elantramafia - @illgner_suarez on Instagram

По вашему - это магия или сила жигули?😂 - Наш хештэг #жигулиюкрейн Отмечайте нас в своих историях - @zhiguli_ua 📲 - #жигули #ваз #лада #дрифт #классика #автоваз #боеваяклассика #ресто #пушкагонка #ретро #автоспорт #дрифт #молодостьнажигулях - @zhiguli_ua on Instagram

#vrythngscks - @miguelangelheco on Instagram

Follow @fukeryy . . #pakistanimemes #pakistan #pakmemersunion #pakmemecouncil #pakmemersleague #paktrendingmeme #pakistanimeme #pakistani #pak #pakmeme #pakmemes #pakistanis#memepakistan #memespakistan #memesofpakistan #fukeryymeme #fukreymemes #funnypakistani #fukrey #razasamo #duckybhai - @fukeryy on Instagram

Even this kid knows whom to respect at that age and there are people opposing the Indian army at Jammu and Kashmir for the encounter. #india #indianarmy #indianpolitics #narendramodi #jammu #jammuandkashmir #antiterrorist #encounter #respect - @mysurupage on Instagram

Gowes sama siapa aja dan kemana saja yang penting bahagia. _______________________________________________________ #gowesindonesia #cycling #olahragapati #cyclinglife #gowesnusantara #goweshore #sepedalipatku #sepedatopbike #bikelife #sepedalipatku #folbi.id #sesegpati #gowespati #fotokerensepedalipat #gowesholic #gowesindonesia #indonesian_cyclist #gowes #sepedalipatku #idfoldingbike #urbancycling #foldingbike #pedalhood #pesepedalipat #sepedalipat #cyclinglife #cyclist #republiksepeda #patihits #tluwah #indonesian_cyclist #gowes #sepedalipatku #idfoldingbike #fotokerensepedalipat #urbancycling #foldingbike #pedalhood #pesepedipat #sepedalipat #cyclinglife #cyclist #republiksepeda #sesegpati #pati #explorepati #indonesia - @sesegpati on Instagram

New Travis tonight can’t wait 😁 - @navslambo on Instagram

- Police officers cry after a failed attempt to stop a woman from jumping off a bridge with her son.

Chillin. Notera minecraft musiken - @alfonsksyt on Instagram

Nampak beberapa Ruas Jalan di Sekitaran Jalan Gajah Mada Sedang di Aspal. . Harap berhati hati & bersabar jika jalanan agak padat merayap 🙏🏼 . . 📸 Photo Credit by Antonius Gunawan Wibisono /FBG/IWJ - @infojember on Instagram

Hmmm • • • • • Sc: @memer.awokawok - @memer_awokawok on Instagram

Couple pics may be graphic but... It’s crazy, it’s been a year. I was locked up on Thanksgiving. A week later, I lost my job and car. A week later, I got shot in the back 🤦🏾‍♂️ needless to say, I was going through it. With all the ppl that lost their lives this year, I just wanna thank God bc I seen them gates and it just wasn’t my time. God I just wanna say THANK YOU 🙏🏾 I know I have a purpose A year later, I’m back on the clock ⏰ back on the road 🏎 and I’m still doing this music 🎧 Most ppl in my position would’ve been folded ‼️ #EBE #NEVERFOLD #WHATSYOURPURPOSE - @djlayup on Instagram

SEMETON STM AT POCARI SWEAT FUTSAL CHAMPIONSHIP 2019 . @smkn1batam @futsalsmksab @semeton.stmsatoe @galeri_smkn1batam @pocarisportid @passionstudent @ultras.school @semetonstmallbase . #smkn1batam #semetonstm #nostmnoparty #passionstudent #ultrasschool #ultras - @semetonstmallbase on Instagram

Pelaku pembunuhan pengusaha rental mobil di Pekanbaru akhirnya berhasil diringkus oleh Kepolisian Daerah (Polda) Riau. . Dari empat pelaku, baru dua orang pelaku yang berhasil ditangkap yakni AN alias Andre (24) dan DV alias Devi (31). Dua orang pelaku yakni DD alias Dodi (38) dan IR alias Irwan (27) masih dalam pengejaran dan dalam waktu dekat akan dilakukan penangkapan. . Kapolda Riau Irjen Pol Agung Setya Iman Effendi dalam konferensi pers di Mapolda Riau mengatakan bahwa kedua pelaku ditangkap di daerah Sumatera Utara (Sumut) pada Jumat (25/09/2020). . Penangkapan berhasil setelah melakukan penyelidikan di Tempat Kejadian Perkara (TKP) disebuah rumah yang tak jauh dari lokasi penemuan jasad korban. . Disana ditemukan barang milik korban berupa minyak wangi dengan bercak darah, HP Xiomi milik korban. . Atas fakta itu kita melakukan pengejaran dan melakukan penangkapan di lokasi panti pijat Jalan Binjai Simpang Binjai Diksi Kota Binjai Provinsi Sumatera Utara, kata Agung. . Pelaku terbilang lihai dalam menjalankan aksinya, korban ternyata dianiaya disebuah rumah milik tersangka AN menggunakan benda tajam dan benda tumpul secara berulang. Hasil pemeriksaan terhadap pelaku, kejahatan ini sudah direncanakan dengan motif ingin menguasai barang milik korban, tukas Agung. . Terhadap pelaku terancam pasal 340 KUHPidana atau pasal 338 KUHPidana dan pasal 365 ayat (3) KUHPidana dengan ancaman hukuman mati atau seumur hidup. (RAL) . Source @riauaktual #BeritaPekanbaru #ExplorePekanbaru - @explorepekanbaru on Instagram

- @kenny_kucing.id on Instagram

🤣😭🤣😭 - @liluziiver on Instagram

Mbok suka yo tok suka😀 - @iksanprayoga_ on Instagram

- North Korea is going to kill me, but it’s worth it.

Hallo sahabat desa? . Gimana nih acara perayaan HUT RI ke-75 kemarin? Pastinya seru dong ya. Suasana serupa pun sama terjadi pada perayaan di Yayasan Pelangi Hati Indonesia di mana Komunitas Kita Indonesia dan temen-temen Relawan Desa Anak Bangsa merayakan agustusan bersama temen-temen autisme. . Mengusung tema merdeka untuk semua acara ini seru bgt. Kita juga berharap temen-temen semua mau berempati dengan teman-teman autisme. Anak-anak berkebutuhan khusus memang spesial. Mereka tidak bisa menyampaikan langsung melalui lisan mereka tapi di dalam hatinya meraka merasakan kehadiran dan seraya berucap terimakasih. . Terimakasih kolaborasi yang keren antara komunitas Kita Indonesia dan Penggerak @desaanakbangsa.id - @desaanakbangsa.id on Instagram

⚠️ La administración de #ParqueSamanes pensando en la salud de sus usuarios, informa a la ciudadanía que cierra temporalmente sus instalaciones debido a la caída de ceniza volcánica. 🌋⚠️ - @parquesamanesgye on Instagram

Wow what could I say about today.. Huge shout out to a day 1 kid of ours.. @elvin_5_ has been made for the 💡 🎥 . Such a gym rat every coach will tell you this kid has a gift.. Wha tips it off is that he jumped over the hometowns Icy’s guy cart, then gets a special guest @bg_mrlesexpress to throw him a super dope pass off the glass.. Man 🤯🤯 not only is he registered to dunk, he’s Registered to VOTE. #TheUnitedWay #GrandpaIsProud #5 #Dunkthevote!!! #Dontgiveupthevote!!!! - @les_united on Instagram

Selamatkan sepakbola tanah air!!! 🔥🔥🔥 - @suara_aktivis on Instagram

Ok this is a 10/10 for me!!! Gooood lord!! @eric10xgingerich Follow @cencal_trucks @mrcencalhimself (personal) @cencalimages (photography page) @trainhorns TikTok mrcencalhimself & cencaltrucks Check out my website for more merchandise. Cencaltrucks1.bigcartel.com link in bio! #cencaltrucks #cencal #duramax #cummins #powerstroke #chevy #chevorlet #ford #GMC #dodge #trainhorn #truckporn #follow #burnout #diesel #california #showtrucks #powdercoat #nathanairchime #trucks #turbo #turbodiesel #sema #photography - @cencal_trucks on Instagram

DESTINASI WISATA KUTA MULAI DI KUNJUNGI WISATAWAN . Kuta yang merupakan salah satu destinasi wisata di Bali perlahan mulai menyedot wisatawan untuk berkunjung menikmati liburan maupun sekedar menikmati wisata belanja. Hal ini terpatau di pada hari selasa (14/07) nampak mulai banyak wisatawan berlalu lalang di seputaran Centro Kuta. . Personil Kepolisian Sudah bersiaga lebih awal untuk mengantisipasi kunjungan wisatawan yang sudah mulai hadir perlahan ke wilayah Kuta. Selain melakukan pengamanan dan pengaturan lalu lintas, Personil Kepolisian dalam Hal ini Polsek Kuta tetap memberikan imbauan kepada para wisatawan agar tetap menggunakan masker dan mematuhi protokol kesehatan selama berkunjung di Bali pada khususnya Wilayah Kuta. . Info @humasrestadps - @denpasar.terkini_ on Instagram

#latepost GESER KE KANAN! Masih dalam suasana Idul Adha, @metrotv @metrotv_sumut mengabarkan berita kegiatan Keluarga Besar Ikatan Pemuda Karya (IPK) dari Gedung Putih pada acara memperingati Idul Adha dengan menyembelih 10 ekor sapi dan 4 ekor kambing di Lapangan Parkir Gedung Putih.. . SOLIDITAS DALAM KEBERAGAMAN PEMUDA! HIDUP IPK!!! HIDUP IPK!!! HIDUP IPK!!! . #ipk #ikatanpemudakarya #gedungputih - @satgasipksumut on Instagram

go watch jattic on @antonii004 youtube linc in his bio (ゝ。∂)ty for the iphone pov @mmankong - @badgerclit on Instagram

10 slide Among Us Memes 😈😈 - @supvroo on Instagram

- Rochester NY protests 9/6/20

Nah tag wong nyo yg laher di bulan itu - @palembangterkiini on Instagram

#beritalampung Tiga pelaku tersangka perampokan berhasil ditangkap. Salah seorang pelaku tewas dalam baku tembak dengan polisi ketika hendak ditangkap di daerah pegunungan Sulung, Sukau, Rabu (25/4/2018) sekitar pukul 01.00 WIB. Jadilah bagian dari #citizenjournalist atau #jurnalismewarga Lampung dengan cara tag foto terbaik mu berikut caption yang jelas ke @lampungco untuk kami repost. Untuk mengirim rilis berita bisa melalui email redaksi@lampung.co atau WA 0816699032 Salam - @lampungco on Instagram

#FBF little known black history facts, your boy almost had his own tv show at the age of 11 lol. This was a pilot called Moes World this kid @mrjuicybeatz tagged me in these clips he somehow found and gave me a flashback lol. The year was 1990 my first official (and one of my only) Offers to play a role. The writer/director @kevinrodneysullivan wrote an amazing script abt a child who gets killed in a car accident whos spirit returns to help guide his family and closest friends. I was that child Moe we selected an amazing cast that was ahead of its time I highlight that bcuz its gonna come up again later. The 1 and only Epatha Merkerson @merk2577 played my mother, Jada @jadapinkettsmith played my sister- little known facts- this was her first pro acting gig and I begged Kevin to hire her(I think that means I discovered her😂). I saw how dope she was as a natural actress as soon as she started saying her lines! Side note-I also had an immediate crush lol but her talent was unmistakable and she held her own with a cast full of vets, no surprise she went on to accomplish the things she did as an actress. Bill Cobbs played my grandpa, Kenneth Brown @kenbrown79 played my lil bro and Duane Martin @duane_martin played my hood hero and star high school hooper, Tisha Campbell @tishacampbellmartin played his high school girlfriend that got pregnant. Little known fact-this is where they first met and the rest is history lol 🤵🏽👰🏽❤️. Rmbr I said the cast was ahead of its time well I say that bcuz look at how much everyone did after this! I also say that bcuz the network which I wont name, passed on the show bcuz they literally said it was ahead of its time they felt like the audience wldnt be able to watch a dead black kid every week bcuz it wld be too heartbreaking. 💔😢 We gave it a great shot tho and now that I know its out there in the digital world I can say with pride if u get a chance go watch for yourself and see what u think. #moesworld #aheadofitstime #jadapinkettsmith #tishacampbellmartin #duanemartin #epathamerkerson #kennethbrown #billcobbs #kevinrodneysullivan #deonrichmond #blackexcellencebeforethetermexisted #realresumesnotmadeupishlol - @deon_richmond on Instagram

Street art From Tangerang - @casual_ultra.indonesian on Instagram

Sejarah Agresi Militer Belanda 1 Pada tanggal 21 Juli 1947, Belanda menggempur Indonesia dengan menyerang Pulau Jawa dan Sumatra. Pasukan TNI yang dikejutkan dengan serangan tersebut, terpencar-pencar dan mundur ke daerah pinggiran untuk membangun daerah pertahanan baru. Pasukan TNI selanjutnya membatasi pergerakan pasukan Belanda dengan taktik perang gerilya. Dengan taktik ini, Pasukan TNI berhasil mempersulit Belanda. Meskipun Belanda berhasil menduduki beberapa kota-kota penting, akan tetapi justru hal ini membuat posisi Republik Indonesia naik di mata dunia. Banyak negara-negara yang simpati dengan Republik Indonesia, seperti Liga Arab yang akhirnya mengakui kemerdekaan Indonesia sejak 18 November 1946. Agresi militer yang dilakukan oleh Belanda terhadap Indonesia memunculkan permusuhan negara-negara Liga Arab terhadap Belanda. Dengan demikian, kedudukan Republik Indonesia di Timur Tengah secara politik meningkat. Dewan Keamanan PBB pun ikut campur dalam masalah ini, dan membentuk Komisi Tiga Negara untuk menyelesaikan konflik ini melalui serangkaian perundingan, seperti Perundingan Renville dan Perundingan Kaliurang. Akan tetapi, perundingan- perundingan tersebut tetap tidak diindahkan oleh Belanda. - @visazor2 on Instagram

Pembangunan Jalur KA Bandara Adi Soemarmo - @satker_ka_jateng on Instagram

Anak @hypemask @hypemasksyndicate jadi ojol ya begini. Gasmask dipake buat narik dan mencegah virus corona. . Video by @agung.hb Ojol @opiiesaputra - @hypemask on Instagram

Slide right to see Officer Karen at work! #TorontoBikeMeets ________________________ 🏍️: 📷: ________________________ #debikerboyz #Bikelife #rideordie #toronto #sportbikesquad #stuntsquad #hooligan #_killswitchbikes #bikeswithoutlimits #streetfighterz #rideRich #stuntride #stuntlife #womenwhoride #motorcyclemafia #rippin_shit #harleydavidson #girlswhoride #sportbikesociety #nationwidebikelife #s1000rr #Cyclelaw - @torontobikemeetsofficial on Instagram

Inondations : Affrontements entre forces de l’ordre et populations à Jaxaay - @bib.tv on Instagram

Kami segenap anak Komplek Mega Cinere mengucapkan DIRGAHAYU REPUBLIK INDONESIA KE 75.. MERDEKA - @anggianggoro on Instagram

Christmas ‘19❤️ @hope4thehomeless_ - @kalothe1 on Instagram

- @deepak_singadd on Instagram

bail funds link in my bio rage, rest, reach out we got each other https://il.ink/protestbailfund - @hardcore.bae on Instagram

Austin Moon was in fact that nigga 🙏🏿 • (FOLLOW ME @biggiefromthevillage) • • • • (ignore tags) #meme #voidmemes #relatable #follow #comedy #dankmeme #dankmemes #explore #flightreactsmoments #nfl #fivioforeign #nbaplayoffs #xxxtentation #lebronjames #explorepage #nba #lakers #nbayoungboy #6ix9ine #funnymemes #future #lilbaby #drake #gunna #playboicarti #roddyricch #nlechoppa #popsmoke #juicewrld #youngthug - @biggiefromthevillage on Instagram

We are letting it all out at #thefrafmentfoomsg The first rage room in Singapore #goodexercise - @mcdlalaland on Instagram

Story share your favorite slide💀 Follow me it’s free💯 help me get to 1k @tjaysgoon @tjaysgoon for more memes🌟 - @tjaysgoon on Instagram

#coldwar #krisisrudalcuba #cuba #amerika #embargo #perangdingin #sejarah #sejarahinternasional #internasional #batista #kennedy #jfk #fidelcastro🇨🇺 #udud #sosialisme #revolusi Follow: @bapak_nasrallah @bapak_sultan_mehmed_5 @baath_indonesia @bapak_assad @bapak_ataturk @bapak_saddam @bapak_gaddafi @bapak_khamenei @bapak_khomeini @hassan.ghzli @memesejarahid @syekh_utsaimin - @sultan_mehmed_5 on Instagram

Koyo Tuban wingi kae 😁 Sukoharjonews.com (Sukoharjo) – Ada yang berbeda ketika berhenti di lampu “trafficlight” atau lampu merah di kawasan perkotaan Sukoharjo. Khusus untuk tempat berhenti sepeda motor, dibuat seperti garis start atau “circuit grade” dalam balapan motor. Hal itu dilakukan oleh Dinas Perhubungan (Dishub) dalam rangka menjaga jarak pengendara motor untuk pencegahan penyebaran virus corona. “Untuk tahap pertama ini baru tiga lokasi yang diberi pembatasan jarak antar pengendara motor saat berhenti di lampu trafficlight atau lampu merah,” ujar Plt Kepala Dishub Sukoharjo, Toni Sri Buntoro, Rabu (10/6/2020). Tiga lokasi yang sudah diberi jarak layaknya garis start balapan motor tersebut masing-masing di simpang empat Universitas Veteran, simpang tiga kejaksaan, dan simpang lima. Pembuatan jarak tersebut sebagai bentuk persiapan Dishub penerapan tatanan kehidupan baru atau “new normal”. Dengan pemberian jarak, diharapkan pengendara motor berhenti di markah yang ada sehingga ada jarak antar satu pengendara dengan pengendara lain. Karena hal baru, Toni mengaku masih memberikan sosialisasi pada masyarakat dengan menempatkan petugas di lokasi. Nantinya, markah atas tanda berhenti tersebut akan dievaluasi. Toni mengaku, dari pantauan petugas dilokasi sejak ada markah tempat berhenti tersebut, masih banyak pengguna jalan yang berhenti tidak sesuai markah yang ada. Untuk itu, Dishub akan mengintensifkan sosialisasi dengan menempatkan petugas. “Nantinya, markah serupa akan kami buat di kawasan Solo Baru, Grogol. Pembuatan markah tempat berhenti ini menyesuaikan kondisi lebar jalan. Jangan sampai pemberian jarak ini justru membuat macet,” ujarnya. Karena masih baru, Toni memaklumi jika masih banyak masyarakat pengguna jalan yang berhenti belum sesuai markah. Namun, setelah masyarakat paham diharapkan dapat berhenti sesuai markah agar ada jarak. (erlano putra) www.sukoharjonews.com/menarik-lurrr-tempat-berhenti-di-lampu-merah-dibuat-layaknya-garis-start-balapan-motor/amp/ @berandasolo @berandaboyolali @berandasragen @berandasukoharjo @berandakaranganyar @berandawonogiri @beranda_klaten #berandasolo #kotasolo #surakarta #kulinersolo #jelajahsolo #explo - @berandasukoharjo on Instagram

OTBX2 by: @hcdrummer .... OUT NOW / @dylanwitkin @_jamelm @lurkbai @nycshawn @macken.r @footlil @_randy.watson @hcdrummer #OTBX #vx1000 #linkinbio #skateboardingisfun - @__andre_beverley on Instagram

Fixing Hennur Road Bengaluru: Maya Sharma NDTV Reports The Hennur Bagalur Road is a toll-free way of getting to Bengaluru airport and as a result has seen a massive increase in traffic but road conditions remain miserable in many parts. Roads are constantly dug up and takes days before they are repaired. Infrastructure projects, like laying of pipes to provide drinking water, go on for years. #FixHennurRoad https://www.ndtv.com/video/news/news/fixing-bengaluru-hennur-rooad-533321 - @hennurtaskers on Instagram

Over 500 views in just 3days....THANK YOU SOO MUCH EVERYONE 🤗❤️.. Jinse nhi dekha do watch it.. Thank you!! 💓 #gudiraam #biru #mrweirdo - @_._mr.weirdo_._ on Instagram

This day was mad 🌬...all about control✅💯🦈 #goodvibes #goodmorning #BSTTO✨ @bombsquad973 🎥 @bs.john @sebikes @toddlyons @bs.dell @rrdblocks @nike @nikesportswear @nationwidebikelife - @bs.drew on Instagram

- Holes 1 through 17 never happened.

Ahmedabad civic body orders closure of shops in select areas after 10 pm - @ourahmedabad on Instagram

Ada yang kayak gini🤣 tag temen lu Follow dan like Partner @squidwardtenpoles09 @dprd.bikinibottom @shitpost.recehan.id @murninya.kebodohan @shitpost.meme.in @lawakan.kartun Sc @squidwardtenpoles09 Hastag #asupanmeme #dagelanmeme #dagelanindonesia #memeindonesia #memefresh #memecringe #memegaring #memespongebob #memespongebobindonesia #ngakakkocak #shitpostindonesia #viralindonesia #shitpostindonesia #hitzeedsamlekom #hatihatidiinternet #kegoblokanunfaedah #randomparatolol #awreceh - @randomngakak.mp4 on Instagram

🚧 𝗣𝗿𝗼𝗺𝗼 🚧 ————————————————— 𝗙𝗼𝗹𝗹𝗼𝘄 @zoomxanime 𝗳𝗼𝗿 𝗺𝗼𝗿𝗲 𝗟𝗶𝗸𝗲-𝗖𝗼𝗺𝗺𝗲𝗻𝘁-𝗦𝗵𝗮𝗿𝗲シ ————————————————— ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ ★ ☆ 𝑇𝑎𝑔𝑠|🚏 ————————————————— #anime #goku #bleach #cowboybebop #aestheticanime #todoroki #sasuke #naruto #luffy #zoro #myheroacademia #animeart #waifus #spikespiegel #drstone #godofhighschool #fireforce #animeopening #onepiece #ichigo #kurokonobasket #haikyuu #kageyama #demonslayer #tanjiroukamado #madara #yuyuhakusho #demonslayermemes #hxh #explorepage - @lil_yngsha on Instagram

- Who watches the Watchmen?

. - @kebegoan.unfaedh on Instagram

@dirtbike_lunatic shared my video! 35k views in 19hours!!! #superquad #quads #police #policeofficer #pulledover #section59 #menace #hometownmenace #ragging #revving - @hometownmenace on Instagram

Diblokir ! . . Seorang warga di Kampung Cibogo Timur, Kelurahan Nyapah, Kecamatan Walantaka menutup akses jalan di beberapa titik di kampung tersebut. Ia mengklaim bahwa jalan yang sudah 20 tahun lebih digunakan sebagai akses jalan warga setempat, merupakan tanah miliknya. “Ini bukan jalan umum, tapi jalan pribadi. Semenjak 94 itu saya bikin pribadi. Surat-suratnya ada saya beli dari 5 orang, Narisa, Sawi, Siti, Manab, Jasudin,” ujar pria yang mengklaim tanah tersebut, Madsari, saat ditemui di kediamannya,Selasa (15/9). Madsari mengakui bahwa memang dirinya mempersilahkan tanah miliknya digunakan sebagai jalan warga. Namun saat itu, ia sedang dalam kondisi ekonomi yang berkecukupan.Berbeda dengan sekarang yang sedang jatuh. “Karena dulu tahun 1996 saya lagi ada,katakanlah banyak duit banyak mobil, cuma sekarang lagi jatuh tidak ada lagi yang bisa dijual.Satu-satunya ini (jalan yang ditutup),” terangnya. Karena kondisinya sekarang sedang membutuhkan uang, terpaksa Madsari menutup jalan dengan harapan agar pemerintah dapat membayar uang ganti rugi jika jalan tersebut ingin kembali dibuka. “700 meter panjangnya lebarnya 4 meter berarti kan 2.800 meter persegi. Saya tidak muluk-muluk minta ganti rugi, sekadar buat bayar utang dan dagang sekitar mobil 1 unit yang seharga Rp100 juta dan uang tunai Rp200 juta,” ucapnya. Bahkan, Madsari menegaskan bahwa jika pemerintah tidak membayar uang ganti rugi, sampai kapanpun dirinya tidak akan memperbolehkan tanah tersebut dijadikan jalan umum. Bahkan apabila dirinya sudah meninggal dunia. “Saya tutup sampai seterusnya.Mohon maaf, kalau pun saya gak ada umur, saya pesan amanah kalau tidak diganti rugi jangan dibuka. Seterusnya ditutup, mau ditanemin singkong juga itu hak saya,” tegasnya. Sementara itu, Lurah Nyapah,Oewin, mengatakan bahwa pihaknya telah berkoordinasi dengan Madsari selaku warga yang mengklaim jalan tersebut merupakan tanah dirinya.Namun ternyata, belum menemukan titik terang dalam penyelesaiannya. Selamat Siang, Selamat Beraktivitas.. Source bantenpos ( terbit Rabu, 16 Sept 2020 ) #infobanten - @info.banten on Instagram

- Waiting for that Pegassi Infernus

DIPPA HEAD TRIPPING OUT #AVA full video on @vahiphopandnews - @dmvhoodzandnewz on Instagram

Vem aí a escolinha de skate da @casadosurfsaquarema Garanta sua inscrição porque as vagas são limitadas! #skate #surf #miniramp #sk8 #radical @sergiosouzaskt - @casadosurfsaquarema on Instagram

: - ગઈકાલે ભરૂચના પાંચબત્તી વિસ્તારમાં ફાયરિંગની ઘટનાથી ચકચાર, ભરૂચના મધ્યે ભર ટ્રાફિકમાં સોનીની દુકાનમાં લૂંટની અને ફાયરિંગ ની ઘટના. . ફાયરિંગમાં દુકાનના માલિકને અને અન્યને ગંભીર ઇજા પહોંચી, લૂંટની ઘટનાને અંજામ આપી 2 અજાણ્યા ઈસમો ફરાર . સીસીટીવીમાં ફાયરિંગની ઘટના કેદ થઈ. પોલીસ ને જાણ થતાં કાફલો ઘટના સ્થળે દોડી આવ્યો હતો. #barodaupdates [ Follow @baroda_updates on Facebook, Instagram, Telegram & Twitter for daily local updates and stories, you can also contact us for Promotion & Collaboration. ] #thebarodianpost #vadodara #baroda #vadodaranews #barodanews #vadodaracity #barodacity #vadodaradaily #barodadaily #vadodradiaries #vmc #barodadiaries #barodian #vadodaradailynews #vadodara_baroda #vadodarabaroda #vadodaradailynews #vadodaratrafficpolice #vadodarapolice #gujarat #india - @baroda_updates on Instagram

Results of open frisbee tournament 2019 Following teams had qualified for the quarter-finals: • FRISBEASTS • STRICT LIABILITY • FIVE AND A HALF MEN • LAL BADSHAH • TOBY KI TEAM • TEAM 4:20 In the quarter-finals, FRISBEASTS got a walkover against TEAM 4:20, STRICT LIABILITY defeated TOBY KI TEAM by 10-4, LAL BADSHAH defeated FIVE AND A HALF MEN by 9-3. In the semifinals, STRICT LIABILITY defeated LAL BADSHAH by 14-3 and FRISBEASTS defeated FIVE AND A HALF MEN by 4-3. In a thrilling finals between STRICT LIABILITY and FRISBEASTS where sweat and blood was shed (literally), the defending champions, STRICT LIABILITY, took over the title one more time. #frisbee #ultimatefrisbee #brodiesmith #frisbeetrickshots - @nujs_sportscom on Instagram

- Im a newb rider doing my first burnout before getting new tires!

Ayok mahasiswa jangan lengah demo terus Atas dasar itulah kami bermaksdus mengingatkan kembali tugas dan kewajiban Polres Sampang kepada masyarakatnya, tuturnya. Sementara, saat di tengah aksi tuntutan yang sudah disebut dalam surat pernyataan tersebut tidak ditandatangani oleh Kapolres Sampang. Kapolres Sampang, AKBP Abdul Hafidz menyampaikan, jika pihaknya siap memberikan perkembangan informasi penanganan kasus kekerasan seksual ini namun, dalam waktu satu pekan sekali. Sedangkan, untuk mempublikasikan nama dan foto para pelaku, menurutnya terlalu beresiko sebab, akan mengganggu proses penangkapan. Jika nama dan foto para pelaku dipublikasikan itu malah membuat mereka terus melarikan diri, ucapnya saat berpidato ditengah demonstran. Mengetahui surat pernyataan tidak mau di tandatangani oleh Kapolres Sampang, berselang beberapa menit kemudian para demonstran membubarkan diri. Namun, sebelumnya para demontran mengaji bersama di tengah jalan raya dan membacakan surat Al-fatihah dengan keinginan tidak tebang pilih dalam penyelesaian kasus. Sumber: tribunnews dan Koran Madura _ #komunitaskabaramadura #kabarmadura #polressampang #madura #maduro #pmii #pemerkosaan - @komunitaskabarmadura on Instagram

- So much fun 🤯

I woke up this morning to news of the government of Liberia clamping down on the peaceful protest organized by young people against the pervasive rape culture in Liberia. This is sick, appalling, and a big shame on the Weah-led administration. To teargas and use violence on a peaceful gathering led by women against a pandemic is beyond unimaginable. I call out Minister Piso Saydee Tarr. Shame on you! Your job demands that you protect the most vulnerable population of Liberia, but you have chosen to align with your political God father. Minister Tarr, who plays politics with the tearing of a three-Year-old vagina? To say I am mad would be putting it mildly. I am angry, infuriated, boiling inside... if you had done your job void of politics we wont be where we find ourselves. Sad, sad, sad... - @leymahgbowee on Instagram

SARONGGI LOCKDOWN...!!! info selengkapnya bisa search di beberapa media online/ media cetak lainnya.. . . Bismillah.. Pandemi ini semoga cepat selesai.. Semangat buat kita semua.. Ayo lebih tingkatkan kedisiplinan kita semua tretan.. Demi kebaikan bersama, ikutin dan patuhilah seluruh anjuran dari Pemerintah 🙏. . . °°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°° 📍 Saronggi 📸 sumber tertera pada gambar °°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°° . . Share foto/ video menarik di sekitar kalian, jangan lupa sertakan lokasinya. Mention dan tag ke @wearesumenep , foto terpilih akan kami repost👌 . . #wearesumenep #sumenep #madura #pamekasan #sampang #bangkalan #saronggi #covid19 #covid #corona - @wearesumenep on Instagram

Bahagia banget dah setiap hari kalau gini sekolahnya [video : sadboi_i \ siktyninee / tiktok] —follow @showmedia.id untuk video unik lainnya 🏬 - @showmedia.id on Instagram

Pie tanggapanmu sooob?😂 Mention orang yang tukang sampah soooob 😂 . . . Cc statuslucu.official Abadikan moment terbaikmu, stay follow, tag & hastag @kerabat_pendaki #kerabat_pendaki - @kerabat_pendaki on Instagram

- 20s 80s Classic pickups.

Who’s club is this?😂😂🤣S/O @audriannachanel for the tag🏷 //TAG A STRIPPER👇👇 #stripper #stripperfights #explore #explorepage #memes - @thedancerslockerroomphx on Instagram

Art gets real in 20 #NandoMotta - @city.wide.artists on Instagram

Terjadi kecelakaan di jalan raya serpong Arah Alam Sutera, sebuah truk terbalik. Sabtu (26/9/2020). Via : @zaewarawiri #infotangsel #tangselife #kabartangsel #Tangerang #Tangerangselatan #exploretangerang #Exploretangsel #bsdcity #bsdserpong #bsdtangerang#gadingserpong #serpong #pondokaren #bintaro #pamulang - @infotangsel.co on Instagram

Siapa yang bertanggung jawab atas sakit? -------------------------------------------------------- 👉 : Tag seseorang 💕 ❤️ : Like, Comment, Share 🔔 : Follow @soearadjiwa_ -------------------------------------------------------- Follow account creatornya: @dionalfa12 . . . . . #puisi #quotes #quotesindonesia #karya #karyapuisi #puisiindo #penulis #story #storywhatsapp #storywa #literasi #path #patahcinta #patah #cinta #galau #karyaanakbangsa #penulis #malang #seniman #senimansastra #karyasastra #puisi #ceritahati #bucin #lukahati #kodekeras #rindu #ambyar #sajakhati #jatuhcinta #sobatambyar - @soearadjiwa_ on Instagram

Earlier today, #DSNY’s Derelict Vehicle Unit, along with our Sanitation Police and @NYPD 61 precinct tagged 29 vehicles, removed 16, and issued summonses to 24. See a derelict vehicle on the street? Report it by calling 311, or at the link in bio. - @nycsanitation on Instagram

- Damned if You Do, Damned if You Don’t

Yg masih make masker buff yok mulai beralih ke masker kain. - @lambeonlen on Instagram

HA-HA-HA . . #lucu #dagelan #lucuabis #ketawangakak #kocakabis #ketawa #rajangakak #luculucuan #ngakak #ngakakabis #ngakaklucu #vivicu #gokil #ngakakanjay #ketawainaja #ngakakonline #gokilbanget #ngakakbanget #bikinramevideo #ngakak_unik #ngakakunik #videolucuabis #videolucu #dagelanviral #jokesbapakbapak #lucugaksih #tiktok - @video_lucu_viral_kocak on Instagram

- Police caught lying about violent ‘assault’ that sent man to jail

Ya allah semoga kita di beri kesehatan selalu aamiin . . . #garut #garutkotaintan #garutselatan #covid19garut #aziafchannel - @aziafchannel on Instagram

- Well deserved

I see y’all hating ass found some to talk about 💯🗣 but if you know me you know I don’t support none of this shit and never encourage the young kids to gang bang, I have a daughter myself ain’t no dead beat I’m here as a father pushing her to the right direction 💯 y’all wanna bash me go ahead but I will never encourage this💯 these kids see so much y’all think they have guidance ?the hood sets us up for failure so young and it doesn’t make it better that we’re losing so many close to us you think they have a way to express themselves ? It doesn’t help if there ain’t no positive role model in there life. But they see me and look at me as a neighborhood hero and that gives them motivation sorry I ain’t got G herbo money 💸 yet if not I would’ve put the hood on for the Kids. Give them somewhere to go when they got no where to go 💯 open a stu in every hood even in the oppz 🤟 so y’all better get y’all hating ass on 🚫🧢 and find y’all something us to talk about TRY AGAIN 🚦 - @kingace3000 on Instagram

#tbt 10 years ago I decided that I wanted to become a rapper, so that’s exactly what I did. I wasn’t thinking this far ahead but here I am in 2020 going harder than ever. I appreciate everybody that’s been supporting me throughout the years and I hope you continue follow my #comeupseason . Much love and respect. Here are a couple “Kayo Da Beast” classic verses 🔥🔥 .⁣ .⁣ .⁣ .⁣ .⁣ #picoftheday #artist #love #fashion #photography #vintage #repost #rapper #rapmusic #likeforlikes #followme #instagood #music #art #comeupseason #me #model #viral #singer #style #follow #beautiful #photooftheday #lifestyle #musician #hiphop #instagram #trapsarentgay - @kayodabeast on Instagram

Brutality, Intimidations, assaults, manhandling and a continuous violations and abuse of the fundamental human rights in the eye of the Law are not a part of Law enforcement! Law enforcement Officers should be careful and desist from taking laws into their hands. You have repeatedly done this over and over and is no longer going to be business as usual! The Rule of Law must be dully respected and followed in cases such as this. STOP This Nonsense Now! OR..... - @fridaysforfuturenigeria on Instagram

Bedug dobol wayahe turu awan eh malah kate ditipu 😑😑😑 Update:bedug dobol = Siang siang panas panas banget ngetangtang puwanas ngelak nganttuk pokok e ngono wes - @ngalamlop on Instagram

Warga Bojong Baru Keluhkan Jalan Raya Bambu Kuning Tergenang Air Warga Desa Bojong Baru Kecamatan Bojong Gede Kabupaten Bogor, Jawa Barat mengeluhkan Jalan Raya Bojong Gede -Ciatayam (Bambu Kuning) tergenangi air. Pasalnya, jalan yang rusaknya sudah berbulan-bulan itu sering makan korban banyak pengendara yang terjatuh belum lagi banyak kendaraan roda empat yang sering mogok. Saya juga pernah terjatuh saat melintasi jalan rusak karena harus menerjang genangan air, ungkap Yeni salah satu warga Desa Bojong Baru saat melintasi jalan tersebut. Hal senada diungkapkan Reza, dirinya terpaksa harus mendorong motor menerobos titik jalan yang rusak dan Seperi kubangan itu demi menjaga agar motornya tidak mogok. Motor saya matiin dan harus didorong karena takut mati,kata Reza. Pengemudi Sopir Angkot Jurusan Bojong Gede -Ciatayam pun bernasib sial saat melintasi jalan tersebut. Saat membawa penumpang angkotnya itu tiba tiba mati karena bagian mesinnya terkena air. Ia ini mati mendadak kena air karena genangannya dalam terpaksa penumpang pada turun karen mobilnya mogok, kata Dedi. Pengguna jalan dan warga sekitar berharap jalan tersebut segera ada perbaikan. Padahal sudah sering dilakukan pengontrolan namun tak kunjung ada terealisasi. - @mediabogor on Instagram

[DIFUNDIMOS] BARRICADAS LEVANTADAS POR EL COLECTIVO LISSETTE VILLA DURANTE LA NOCHE DE HOY EN NUESTRA COMUNA. REPRODUCIMOS SU COMUNICADO. Chiguayante, 5 de septiembre del 2020. Día de agitación y demostracion antifascista. Barricada simbólica en Leonera,calle Manuel Rodríguez esquina Calle Italia. Hoy bajo el llamado de demostración y lucha antifascista, Lissette Villa se hace presente utilizando el fuego como foco de atención y propaganda subversiva. Bajo esta acción es necesario exponer 4 puntos. 1- insistimos en el llamado a todx lx gente que tiene ese fuego rebelde en su interior, a salir y seguir tomándonos las calles. Agitando en nuestrxs territorios en contra de este estado policial y toda su mierda de leyes truchas y corruptas que solo perjudican a la clase trabajadora y benefician a lxs mismxs de siempre, la burguesía capitalista y neoliberal. 2 - insistimos en no olvidarnos que la lucha por lxs niñxs es una pelea que nos concierne a todxs y en apoyo al colectivo @madres_desesperadas . Exigimos respuestas sobre el paradero de lxs niñxs dados en adopción de forma ilegal, y tambien exigimos juicio y castigo para Evelin Oñate. Violadora y pederasta, quien es acusada con pruebas, de que permitió y dirigió el.comercio sexual de menores con niñxs de 3-8 años de edad. NO MÁS SENAME. 3 - el fuego duró un poco más de 35 minutos, hasta que llegó una camioneta de la armada de Chile, cargadita de infantes de marina. Hoy nuevamente le hicimos la bicicleta a los cosacos. Pasamos piola y nos retiramos tranquilamente como si nada pasara. Las calles son nuestras. Los perquines del estado no conocen nuestras poblas más que nosotrxs mismxs. 4 - por último queremos dejar el siguiente mensaje; ¡ que el fuego que está dentro de ti, renazca con fuerza y se transforme en coraje y rebeldía.! ¡ a formar y crear la lucha antifascista en todas las poblas! . ¡ por la libertad de todos los pueblos. Organizacion y acción directa en todos los territorios !CTVX Lissette Villa. #anarquía #antifascismo #nomássename #dondeestanlxsniñxs #evelynoñatevioladora #carcelparaevelinoñate - @chiguayanteorganizado on Instagram

. 🌆 Dia do carnaval SP 🌆 . . . . . 🙏🙏🙏 muito obrigada @brunnao_13 e sua familia 🔝🔝🔝 . . . . . . . . #slackline #training #slacklife #highline #contact #brasil #slackdance #jibline #conaltura #dance #art #slackgirlsaroundtheworld #france #sp #outdoor #statictrick #balance #equilibrio #slacklinebrasil #slacklinefrance #trickline #movement #brazil #rider #surf #yoga #saopaulo #statictrick #carnaval #urban - @claire_slackline on Instagram

THE #BALLOUT DUNK FREESTYLE 🔥 Rate the dunks in the comments From @allah_bam to @elijahmensahjnr, swipe through the #ballout dunks to select your favourite dunk! - @umat_mbb on Instagram

Si No Hay Justicia Para El Pueblo Que No Haya Paz Para El Gobierno” - Emiliano Zapata If There Is No Justice For The People, Let There Be No Peace For The Government -Emiliano Zapata 14 Miles From The Eastside To Seaside. Black & Brown Unity! I We Marched To Show Strength, Unity & Solidarity. To All Those Families Whose Sons and Daughters Are Victims Of Injustice, I Marched For You Alongside My Brothers & Sisters Dé Color. Viva Mi Raza! Viva La Revolución! Viva Las Mujeres! The Struggle Continues... #justiceforvanessaguillen #justiceforbreonnataylor #noindependence #nokidsincages #BLACKANDBROWNUNITY #black #brown #unity #blackandbrownlivesmatter #blackandbrownlivesmatter #vivalaraza #sisepuede #brownissues #VANESSAGUILLEN #SEASIDE #SALINAS #SOLIDARITY #tuluchaesmilucha #montereycounty #milpa #greenfield #yourstruggleismystruggle #freeourkids #defundthepolice #resistance #revolutionary #revolution #chicanomovent #latinx #striveforgreatness #riseasone - @avilavictoryboxing on Instagram

Mpssssaaaaahhhhhhhhh Bau ketololan🗿 - @giap8899 on Instagram

- blursed_race

Kamis, (1/10) Pagi tadi #Kecelakaan Mobil B 1681 SRT terbalik menabrak pembatas jalan didpn Pulau Dua DPR/MPR, Jakarta Pusat. Via : TMC Polda Metro Jaya #InfoJakartaPusat #JakartaPusat - @info_jakartapusat on Instagram

#team05#RPRacing🏁 - @____piyush05_ on Instagram

Jan cubo - cubo dak pakai Masker Sanak. Batusangkar, Padangkita.com – Pemkab Tanah Datar akan memberlakukan sanksi terhadap pelanggaran protokol kesehatan mulai awal Oktober. Sanksinya mulai dari teguran tertulis hingga denda sesuai dengan Peraturan Bupati (Perbub) tentang Penerapan Disiplin dan Penegakan Hukum Protokol kesehatan. Kasi Penegakan Perda Satpol PP Tanah Datar, Elfiardi mengatakan tahap sosialisasi Perbup telah dilakukan dan akan berakhir pada akhir bulan ini. Sehingga, awal Oktober, penindakan dengan sanksi akan diterapkan. “Sejauh sosialisasi ini (penggaran) baru sebatas teguran secara lisan. Belum ada penindakan ataupun teguran secara tulisan,” ujar Elfiardi kepada Padangkita.com, Senin (28/9/2020). Elfiardi mengatakan, sesuai Perbup Tanah Datar, penindakan akan diberikan kepada yang melanggar dan tidak menerapkan protokol kesehatan, baik itu perorangan, maupun pelaku usaha. Sejauh ini, sebut dia, Bidang Trantibum Satpol PP Tanah Datar terus menggencarkan sosialisasi Perbup tersebut. “Dalam tahapannya, memang sampai akhir bulan ini akan dimaksimalkan sosialisasi, baru setelah itu kita lakukan penindakan,” ujarnya. Perbup Tanah Datar menindaklanjuti Instruksi Presiden No. 6/2020 dan Instruksi Mendagri No. 4/2020. Dalam Perbup itu, yang menjadi subyek adalah perorangan, pelaku usaha, pengelola atau penanggung jawab tempat dan fasilitas umum (perkantoran, tempat kerja, usaha dan industri, sekolah atau institusi pendidikan lainnya, tempat ibadah, terminal, transportasi umum, toko dan pasar, warung makan sejenisnya, dan tempat wisata, dan lain-lain yang bersifat memungkinkan adanya kerumunan masa). Pada subyek perorangan, warga berkewajiban mematuhi aturan seperti memakai masker, mencuci tangan, pembatasan interaksi fisik (psysical distancing), dan perilaku hidup bersih dan sehat. Sumber : https://padangkita.com/ingat-awal-oktober-pelanggar-protokol-kesehatan-di-tanah-datar-bakal-disanksi/ #tanahdatar #covid19 #sumbar #salingkatanahdatar Lanjut komet 📍 - @salingkatanahdatar on Instagram

Komisariat Armed1 - @pshtmalangbarat_ on Instagram

Location scouting! That’s how we roll!!!! #welovewhatwedo #serviceproduction #productionmanagers #weloveourjob - @la_banda_l on Instagram

- Say no to fakeass bitches in 2019 😤😤😤

- @twigharper_artificial on Instagram

Follow @mecin_69 jangan mampir doang !! . Repost Tag 🔥. . . Follow @mecin_69 @mecin_69 @mecin_69 . . Tag . #memeupinipinindonesia #memeupinipin#memeindonesia #memekocakindonesia#memekomikindonesia #memefresh#memespongebobindonesia #memespongebob#ngakakkocak #memengakak #memekocakindo#memekocak #bijikers #erpanmeme#memeerpan1140 #memepage #asupanmeme#dagelanmeme #upinipinmeme #erpan1140#recehantwitter #receh #memes #twittermemes #asupanmeme - @mecin_69 on Instagram

Had a great time with friends today at Oakland Valley Race Park for the Endurance Karting Northeast Grand Prix. Thanks to Adam Owens, Trevor Dawe and @jessicatracy for inviting me to tag along. It was a absolute blast! I was able to snag the fastest lap in class and was .05 away from having the fastest overall lap of the race. But it was set by a kid that weighed 100lbs so I’ll take it! - @itspetebank on Instagram

See how the body position changes Indian govt, or Mumbai police, Who can explain this to us?? #justice #teamssr #dilbechara #dilbecharaonbigscreen #sushant #teamssr #justiceforSushantforum #justforsushi #JusticeForSushantSinghRajput #justiceforsushantsinghrajput #ssr #sushantsinghrajput❤ #sushantsinghrajput #sushant #MissYouSSR #MissYouIDOL #missyou #sushantsinghrajputlovers #sushi #sushantmerijaan #sushantsinghrajput😍 #sushritisdreamer #sushantsinghrajputfanclub #sushantstories #sushilover #sushi #sushantsinghrajput_forever #sushantsingh #sushantsinghrajputteam #sushantsinghrajputworld #sushantsinghrajputfan_club #sushantsushi - @sushant__sushi on Instagram

Wilujeng Enjing Wargi Cimahi. Setelah melaksanakan upacara, saya diminta nganter anak-anak Paskibraka Kota Cimahi tahun 2020 yang telah menyelesaikan tugas mengibarkan Duplikat Bendera Sang Merah Putih dengan baik ke check point di Gor Sangkuriang pakai Sakoci baru yang dimiliki Pemerintah Kota Cimahi. Dengan masih menggunakan baju putih, saya sendiri yang langsung nyetir sambil mencoba Sakoci baru, ditemani berbagai yel-yel dari anak-anak Paskibraka Kota Cimahi tahun 2020. Kalian Luar Biasa ! #CimahiBaru - @ajaympriatna on Instagram

#Repost @yemenforgotten ・・・ Another ruthless act that nearly put this child’s life at stack taking place in Taiz, a city thats been merely disowned and utterly fabricated by most people who believe the Houthis are not to blame, what gets me is that every single time when something so vile happens in Taiz and when the houthis are mentioned, there are people jumping on the bandwagon and saying its FAKE news! Not even one has said if the child was okay after been deliberately sniped just because she was carrying a water tank to bring back home with her brother, but yet the day of collecting a water tank caused nothing but blood shed as the girl is found lying in her own blood and her brother is trying to pull her out just to get to a safe zone, life in Taiz isn’t ordinary, children cant even get water because that alone is enough for the houthis to murder or ruin childrens life permanently! This shouldnt be the life for innocents but yet it still is, houthis need to be held to account, they are the killers like the Saudi coalition, if these houthis are not accounted for, they will continue with nothing but bloodshed! • @withregram @ymnsforgottenchildren_ A painful scene from Yemens city of Taiz, the city the international organizations continues to turn a blind eye on our Yemeni children since 2015. The child Ruwaida 10-year-old was pulled by her brother after she was shot by Houthi sniper in the Rawdah neighborhood in northern Taiz city while bringing water for her family. ‎لا حول ولا قوة إلا بالله حسبنا الله ونعم الوكيل ‎#تعز #اليمن #اطفال_تعز #اطفال_اليمن #yemen #taiz #childrenofyemen #taizcity #عين_الانسانية_عمياء_عن_تعز #human_eyes_absent_from_taiz #notatarget #children #childhood #stolenchildhood #taizhumantragedy #ourkidsmatter #saveourchildren #endtaizsiege #kids #yemenikids #nochildleftbehind #forgottenchildrenofyemen #nochildinwar #savelives #savechildrenofyemen #achildisachild #saveourkids #humanityisdead # - @save_yemen on Instagram

It make no sense‼️ Follow me if you’re from explore @21sseed ❤️ Collab with the bro @10kslvmp • • • • #llj #playboicarti #wlr #foreigner #funnymemes #memes #dailymemes #wholelottared #explore #viral #views #lol #lmao #dankmemes #memesdaily #haha #comedy #twittermemes #instagram #instagrammemes #explore #funny #explorepage #comedy #offensivememes #wholesomememes #llx #funnyvideos #funnymemes #worldstar #liluzivert - @21sseed on Instagram

Tengah hari bolong... Ya Allahh 🤔🤔🤔 . . . . . sc @netijenrii @gojek24jam #regrann #infoojol #ojol #jabodetabek #online #ojekonline #gojek #grabbike #indonesia #ojolindonesia #loker #lowker #kerja #ojoldrama.id #dramaojol #newdramaojol #meme #memeindonesia #dagelan - @ojoldrama.id on Instagram

- Rochester NY protests post-pepper rounds 9/5/20

#Repost @missionpossiblepune ・・・ APAALING. SHOCKING DISTURBING. Swipe to watch the entire video 👉 It’s hard to imagine what type of monsters would simply cast aside their pets, but sadly, it happens. . This video is a heartbreaking look at what abandonment really is and how low humanity can stoop. . When we politely refused to take in this girls PET CAT, she tried to blackmail us by telling us that she will write bad reviews about our shelter. Unfortunately, we are overburdened with sick, abandoned and injured animals, flowing into our shelter. It is not possible to keep animals in our shelter, as we have no more space, which is why we are requesting individuals to bring sick animals for treatment everyday but take them back. . This young lady came back an hour later and DUMPED her pet cat right outside our gate and like a coward ran away in her luxury car for which she probably paid lakhs of rupees, but cannot afford to take her cat to a vet and save its life. . Little did she know, her vicious act was being caught on camera. WE HOPE WHOEVER RECOGNISES HER, INFORMS HER THAT SHE WAS RECORDED ON OUR CCTV CAMERA. . MISSION POSSIBLE IS AN NGO IT IS NOT GOVERNMENT FUNDED. . WE ARE STRUGGLING WITH THE LOAD OF OVER 1200 ANIMALS IN BOTH OUR SHELTERS. . Please have a heart before randomly sending people to us to surrender or abandon their pets. . There is only so much we can do, after all we are living beings too and we work day and night, without proper sleep or vacations, LITERALLY to save lives. . . We are a shelter, and while we will do everything in our power to help every animal that walks through our doors, we do not have unlimited resources. We do not have a vet on staff. . Shelters of this MAGNITUDE, such as ours rely heavily on financial support and staff, beside so many other important factors. . MY REQUEST TO ALL WHO HAVE DUMPED THE SICK AND INJURED AT MISSION POSSIBLE AND NEVER LOOKED BACK, PLEASE COME FORWARD AND TAKE THEM AS WE HAVE A HUGE SHORTAGE OF SPACE. #animalrescue#animallovers#dogsofinstagram#rescuedogsofinstagram#pune#dogsofindia#punediaries#punetimes#missionpossiblepune#dogsofinstagram#weeklyfluff#rescuedog#rescued#animal - @petsofpune on Instagram

Kecelakaan Truk Boks asal dari Kota Pekalongan Tabrak Pengendara Sepeda Motor di Jalan Soekarno - hatta, Purin, Patebon-Kendal. Korban pengendara motor matic Beat mengalami kerusakan pada bagian belakang, dan Korban mengalami luka parah. Sedangkan sopir truk hanya mengalami luka ringan, dan diminta keterangan saat TKP berlangsung oleh anggota @satlantas.polreskendal Repost dari : @liputan.kendal.terkini #kendal #instakendal - @insta_kendal on Instagram

- Its bound to happen eventually.

Disampaikan ada Urang Ngamuk Didepan Rs.Ulin Perihal sebab tidak jelas, namun sudah di Amankan Oleh Pihak Lantas Dan Warga Setempat Bagi yang mengetahui silahkan tambahee lagee terkait info menarik terkait banua ~ @banjar24jam Credit to @ini_polisi - @p0lri on Instagram

Let’s be clear: the current climate in Louisville is a sheer example of just how easy it is for the media to manipulate and distort our emotions. Panic is their currency and mayhem is their value. This will only worsen if we continue to abandon the biblical values that founded this nation. “Our Constitution was made only for a moral and religious people. It is wholly inadequate to the government of any other.” ~ John Adams Long live the republic. ... #dangerousbutgood // #faithfamilyfreedom - @dangerousbutgood on Instagram

- hmmm

- some of the aftermath of the Boksburg cash-in-transit heist on the R24

Aksi solidaritas kali ini di bubarkan aparat, tapi tidak apa2 maju terus pantang mundur, jangan pernah menyerah menuju cahaya. Di sadur dari sumber @ekarock dan @osdbali #BebaskanJRXSID #JRXSIDtidakbersalah #KamiBersamaJRXSID #kuatkitabersinar #nyalakantandabahaya 🛠©️ Semua hak dan kredit dimiliki oleh masing-masing pemilik konten🛠⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⚡️Apabila ada pelanggaran konten atau pelanggaran hak cipta yang dimaksudkan, mohon DM untuk setiap permintaan atau penghapusan⚡️ - @jrx_meme on Instagram

Nos reportan: TIPIFICACIÓN*: Da cuenta de accidente tto que involucra a PNI, lesiones de carácter grave sin riesgo vital. HORA: 14:40 hrs. LUGAR: Calle Cerro El Plomo con Calle El Altar Comuna: Valparaíso Unidad: Subcomisaria Placilla Hechos: En el Lugar y hora señalada por un llamado de la central de comunicaciones con la finalidad de verificar un robo efectuandose en la carga de un camión, situación que generó que concurrieran personal motorizado a prestar a cooperación al jefe del turno, por razones que se investigan el Cabo 2do. De nombre: AXEL SILVA RELEHUI, que conducía la motocicleta todo terreno M-6271, Accion: colisiona de forma frontal con un vehículo menor lo que generó que el citado PNI saliera proyectado hacia el parabrisas del vehiculo ocacionado lesiones de fracturas expuestas de ambas piernas, siendo trasladado de forma urgente al Hospital Carlos Van Buren Documentación: Conductor del vehiculo menor con totalidad de la documentación al día. PNI se encuentra debidamente habilitado para conducción de Motos todo terreno, encontrándose en normal estado de intemperancia. Curso de acción:. Se constituye el Subcomisario Cap. Bolivar Briones con personal suficiente, personal Siat, personal Samu, se aisla el S.S. Se da Cuenta a OS.1 - @defensamotorizada on Instagram

- Screenshot from stand news. Hong Kong police stopping passersby on the streets.

Nah u pilih mana dah.. anyep apa adanya?! Semnagat bang jek🔥🔥 . . #ceritaojekonline #dramaojol #gojek24jam #ojol #gojek #grab #gosend - @ceritaojekonline.id on Instagram

Fordham earlier. - @nyartists_ on Instagram

Sing wingi lurr 🤔⠀ ⠀ Aksi keplek miring yang pengendara sepeda motor di jalan raya Tawangmangu-Sarangan tepatnya di Cemara Kandang viral di media sosial sejak Minggu (27/9/2020). Satlantas Polres Karanganyar mengaku sudah mengantongi identitas pengendara tersebut.⠀ ⠀ Aksi tersebut terekam kamera handphone seseorang yang berada di lokasi kejadian. Video memperlihatkan pengendara Yamaha R25 menikung di jalan depan Bukit Sakura Lawu atau dari arah Tawangmangu ke Sarangan. Di bagian akhir video itu si pengendara motor ini menyentuh aspal sehingga membuat tubuhnya terpental.⠀ ⠀ Kasatlantas Polres Karanganyar, AKP Maulana Ozar, mewakili Kapolres Karanganyar, AKBP Leganek Mawardi, menyampaikan polisi sudah mengantongi identitas pengendara yang melakukan aksi keplek miring tersebut. Dia menegaskan aksi tersebut membahayakan pengguna jalan lain.⠀ ⠀ “Pengendara sepeda motor bergabung dengan komunitas motor. Tempat tinggal bukan dari Soloraya,” kata Kasatlantas saat dihubungi Solopos.com, Senin (28/9/2020).⠀ ⠀ Satlantas Polres Karanganyar mengaku kecolongan lantaran rutin melaksanakan operasi kendaraan di kawasan tersebut. Sasaran utama adalah pengendara yang menggunakan knalpot brong atau melanggar ambang batas kebisingan. ⠀ ⠀ https://www.m.solopos.com/polisi-kantongi-identitas-pemotor-beraksi-keplek-miring-di-cemara-kandang-siapa-dia-1083496/amp⠀ ⠀ From @agendasolo ⠀ #info #cegatan #solo #infocegatansolo #infocegatansoloraya #agendasolo #kotasolo #Surakarta #exploresolo #kabarsolo #eventjateng #jajansolo #jelajahsolo #berandasolo - @info.cegatan.solo on Instagram

Scenes from #kharghar ☹️ Credits: Riya 🙏 - @navimumbai.in on Instagram

Gunna was ready to rumble 😈💯 • • • • • #Dankermemer #danker #dankestmeme #dankmemesmatter #dankhumor #russianmemes #dankmemesgang #dankvideo #memekid #dankdank #memeboo #yeetmemes #morememes #shreckmemes #normiememes #communismmemes #funnyclips #comedymemes #thewallofcomedy #communistmemes #explore #explorepage #laflame #firememes #offensivedailymemes #offensivehumor #cringeworthy - @kobefromtexas on Instagram

Telah terjadi lakalantas di Desa Ngemplak Baureno, seorang laki-laki paruh baya meninggal dunia di lokasi kejadian. Belum diketahui kronologi pasti dari peristiwa tersebut. Yang paham bisa oret2 dikomen. Sumber istimewa - @berita_bojonegoro2 on Instagram

Collab with my son @lil_tentacle_ you should follow him😎 - - - - - - - - - - - - - #cashcarti #vlone #coryxkenshinedit #thanoscar #offensivememes #dankmemesmeltsteelbeams #kissingthehomiesgoodnight #wholelottared #igor #tylerthecreatoredits #gore #meme #obunga #cartisnippet #citymorue #flightreactsmemes #babypluto #zillakami #nohomo #sosmula #iwontletyougo #ghettofights #ps5 #5gummemes #ps5memes #poopfart - @lilrooach on Instagram

Parade CRF Merdeka 2k20 . . . . . Merah Putih kan Jalanan Kibarkan 🇮🇩🇮🇩🇮🇩🇮🇩🇮🇩🇮🇩 HUT NKRI ke 75 . . follow @crfjakartaadventureclub . . #crfjakartaadventureclub #crfjakarta #crfownerjakarta #crfownerindonesia#brapbrap #crf150lindonesia #honda #hondacrf #crf150l #crfindonesiaadventure #motocross #enduro #adventure #supermoto #trailindonesiaadventure #crfindonesiaadventure #jangantakutadventure #galeritrabasindonesia #trabasindonesia #jakarta #indonesia #bersamahonda #hondacommunitybersamaindonesia - @crfjakartaadventureclub on Instagram

Who wants to go again @12 👀 y’all made 71st lit 😭🤣 Video by @tyler_5.oh - @sleazemafiaa on Instagram

Ziarah Warga Ke Makam Pahlawan Revolusi Di TMP Kalibata Lancar, Massa Pendemo Gagal Menganggu Lalu Ngibrit Ketakutan , Jakarta - Hari ini, Rabu (30/9/2020) adalah hari yang memilukan bagi rakyat Indonesia, karena tepat 55 tahun lalu, Partai Komunis Indonesia (PKI) melakukan pembantaian keji terhadap para Jendral, lalu Mencenplungkan jenazah mereka ke sebuah sumur kecil di daerah Lubang Buaya, Jakarta Timur. Karena itu hari ini umat Islam, warga masyarakat beserta para purnawirawan TNI berziarah ke Taman Makam Pahlawan (TMP) ke Makam para Pahlawan Revolusi korban pembantaian PKI. Alhamdulillah kegiatan Purnawirawan Pemgawal Kedaulatan Negara (PPKN) Ziarah KE TMP Kalibata dalam memperingati G/30/S/PKI ini berjalan sukses. Namun ironisnya, di acara ziarah ini muncul massa pendemo liar yang berusaha mengganggu. Sepertinya baru sekali ini orang sedang berziarah ke kuburan ada yang mau ganggu. Namun alhamdulillah berkat kesigapan dari para massa anti PKI antara lain dari Satgas FKKBM (Purn Baret Merah), Purn Marinir, Purn Kostrad, FKPPI, PPM, FPI, BAT-FPI, Jawara (Bang Japar), BJB 411 dan lainnya para pengganggu dapat di usir dan dipukul mundur bahkan kocar kacir mereka ngibrit lari ketakutan. Ikut hadir mantan Panglima TNI Pak Gatot Nurmantio, Mantan KSAL (Slamet Subianto), Mantan KSAU (Imam Sufaat), mantan Danjen Koppasus Mayjend Sunarko, Mantan DanKor Marinir Letjend Mar Suharto serta ratusan Pati, Pamen, Pama, dan Bintara, serta tak lupa emak-emak militan yang juga hadir penuh semangat. @m4c4n_h1t4m @militertvnegara @putra_militer - @putra_militer on Instagram

Penyemprotan cairan probiotik guna mengantisipasi adanya penyebaran Covid-19 giat dilakukan oleh MRI-ACT Banten. Aksi ini dilakukan di pusat kota aktifitas masyarakat Kabupaten Pandeglang bersama Satpol PP dan instansi lainnya. Dengan penyemprotan probiotik, para relawan berharap tidak timbul klaster baru penyebaran Covid-19. #covid_19 #coronavirus #masyarakatrelawanindonesia #semuabisajadirelawan #banggajadirelawan #relawantangguh #indonesiarelawan #indonesiadermawan - @mripusat on Instagram

Kecelakaan yang melibatkan dua truk terjadi di jalur poros Nasional Lamongan-Gresik, tepatnya di Desa Plosowahyu Kecamatan Lamongan arah Surabaya, Kamis (1/10/2020). Sebuah truk trailer bermuatan pelat besi menghantam bagian belakang truk trailer bermuatan semen. Kronologi kejadian ketika truk trailer bermuatan semen dengan nopol L 9291 UG yang dikemudikan Ali Ifron (34) melaju dari arah barat ke timur dengan kecepatan kurang lebih 40 km per jam. Sesampainya di lokasi, Ali memperlambat laju kendaraan karena akan masuk gudang yang memang berada di tepi jalan. Naas pada saat bersamaan dan dari arah yang sama, di belakang truk trailer bermuatan semen tersebut meluncur truk trailer dengan nopol L 8870 UL bermuatan pelat lembaran besi yang dikemudikan Suprastyo Utomo (28) warga Desa Kenongo, Kecamatan Sedan, Rembang Jateng. Truk muatan lembaran besi melaju dengan kecepatan lebih kurang 70 kilometer per jam dan karena jaraknya sudah sangat dekat sehingga terjadi tabrakan 2 truk ini tidak terhindarkan. Akhirnya truk trailer muatan lembaran besi menghantam bagian belakang truk trailer semen yang ada di depannya. Saat melintas dan hendak mendekati gudang semen, Ali mengaku sudah mengurangi kecepatan karena hendak belok dan masuk gudang. Beruntung tidak ada korban jiwa dalam kejadian ini namun sopir truk yang menabrak mengalami luka di tangan kanan. Petugas Satlantas Polres Lamongan juga berjaga di Karanglangit untuk memecah arus lalin, termasuk yang ada di timur Kali Plalangan. Arus kendaraan pun merambat sejak pagi hingga bangkai truk berhasil dievakuasi dengan truk derek sekitar pukul 08.45 WIB. Selalu Hati-hati dan waspada lur! Source : Detik.com Foto : @vitauzlifatul via DM #lamongan #beritalamongan - @berita_lamongan_ on Instagram

Best gift ever!😍 1 or 2?👇🏻 Which bike would like to get as a gift for your birthday 🤔? Love Super Bikes? Follow👉 @sport.bikes.club for more! Via @dastist.fantastish - @sport.bikes.club on Instagram

Had to make another school meme for the ones that wanted it ! Comment your favorite slide Follow @ian4eal Follow @ian4eal Collab: @cartisredhair - @ian4eal on Instagram

Kecelakaan tunggal pengendara sepeda motor F 6774 UAT di depan Kampus Muhammadiyah Ciputat Tangsel, pengendara tutup Usia saat ini sedang penanganan Polri pagi tadi, Kamis 1/10/2020. . Untuk update info terkini di Tangerang...? . Follow: @tangerang.terkini Follow: @tangerang.terkini Follow: @tangerang.terkini Follow Sekarang Nanti di follow back! . #tangerang terkini update info terkini di Tangerang! . Credit by: TMCPoldaMetro . #tangerangterkini #tangeranghits #tangerangcity #tangsel #tangerangkota #tangerangfood #tangerangfoodies #tangerangolshop #abouttng #lokertangerang #kotatangerang #kulinertangerang #tangeranginfo #exploretangerang #distrotangerang #olshoptangerang #kabupatentangerang #infotangerang #tangerang #tangerangselatan #bintaro - @tangerang.terkini on Instagram

An officer in Pacoima helped save a disabled man seconds before the car went up in flames. If you have any stories or news of positive police encounters, please send them in. We are looking for more positivity and appreciation of officers! What Happened: Los Angeles Police Department (LAPD) has released bodycam footage of the dramatic rescue which took place on Friday. Officers in Pacoima were out on patrol when they spotted a smoking car near Laurel Canyon Boulevard and Paxton Street at around 6 p.m. The video, released on LAPDs Twitter feed, shows the officers near some traffic lights. As they approach the car, thick clouds of smoke start billowing towards them. They can be seen talking to a man before lifting the disabled driver out of the car and carrying him to safety placing him on a grass verge. Seconds later, the car goes up in flames. #ThinBlueLineMedia - @thinbluelinemedia on Instagram

The progress tho.... Shoutout to @lady_tazz2121 , way to hang in there... #stuntdaily #stuntdailyco @stuntdailyworldwide - @stuntdailyco on Instagram

Copwatchers captured this image of counter protestors on the ground flicking off trump supporters while cops have guns drawn on them. This was taken after the failed attempted assault from the right wingers side 🤡 .. .. All men detained were not charged of any crime & let go. Trump supporters obviously were never apprehend for their actions because the cops & the klan go hand in hand 🐷👻 - @frisco_copwatch on Instagram

- Liberal Hate

- @wizar_urbex on Instagram

Why put the article in the crime section? 😑Absolutely pointless reporting. Most of us are just enthusiasts who share the same passion. #a10meets #ghettostreetmeet #northlondonmeets #boosted #modifiedcarscene - @a10_meets on Instagram

What did you get sent to the principal office for in school for 5th slide? - @ottofunny on Instagram

- Blursed_driving

Diberlakukan kembali penutupan jalan malam ini dalam rangka AKB diperketat dibeberapa titik Jalan pusat Kota Bandung. . Diimbau agar selalu menerapkan protokol kesehatan gunakan masker, jaga jarak, dan sering mencuci tangan 🙏🏻 Rabu, 30/09/2020 . Via : @pdkt.dishubbdg #infobandungkota #infobandung #bandungnews #bandungupdate #bandung #bandungjuara - @infobandungkota on Instagram

Video. Last pass of season, stock redeye, full weight. 10.27@134. #redeye #challenger #srt #797 #destroyergrey #hellcat #mopar #dodge #hemi #americanmuscle #hemirace #dodgegarage #dodgelife #dodgeofficial #dodgechallenger #hellcatcharger #moparlife #dodgenation #atcoraceway #atcodragway - @srt__sean on Instagram

- Idiots like this worry me more than cars when filtering

Peluh dan lelahku untuk keluarga. #pejuangkehidupan #snapshot #streetphotography #humanlife #candid #traffic #jakarta #goprohero4black #7skypictures - @7skypictures on Instagram

Pembubaran aksi demo di uncen bawah - @info.papuaterkini on Instagram

Follow @pendakisenusantara . Apa yang tepat untuk menggambarkan kejadian diatas? . Sabarrrrrrrrr . . Kejadian di perbatasan jonggol kab.bogor dengan cibarusah kab.bekasi. . . . . 🎥Video credit dm . #pendakisenusantara #diatasmdpl #viral #news - @pendakisenusantara on Instagram

This is so true - @yunosmemes on Instagram

Masa-masa SMA saat menunggu di gerbang sekolah untuk bergeges pulang karena ada rapat guru😅 . Ada yang pernah alami? . Jangan lupa tag temanmu... - @makassar_iinfo on Instagram

Abeng Marco alias Cecep ketua preman terminal cicaheum di film Preman Pensiun kena PRANK oleh anggota Satpol PP Kab. Garut sewaktu melintas di jalan A. Yani Kab. Garut #bupatigarut #wakilbupatigarut #kanghelmi_budiman #diskominfogarut #pemdagarut #satpolppindonesia #gosipgarut #satpolppjabar #humas_jabar #infogarut #ieugarut #porosgarut #ridwankamil #jabarjuara #bpbdgarut #garuthits #garutkekinian #riswandi1804 #abenk_marco - @satpolppgarut on Instagram

- @antilles_binks on Instagram

Buat Depokers mohon hati-hati dan lebih waspada saat hendak melewati perlintasan rel kereta khususnya di Depok. Karena masih banyak kejadian pengendara tertabrak kereta. Patuhi peraturan yang ada ya gais. Tadi pagi terjadi motor tertabrak kereta di perlintasan kereta Jalan Dewi Sartika - Kartini Depok hingga korban meninggal dunia dan motornya ringsek. #Repost @depok24jam . . . . Untuk update informasi Terkini seputar Depok ? . Follow @depok.kini Follow @depok.kini Follow @depok.kini . . . . #depok #jawabarat #explorejabar #cinere #limo #bojongsari #depokinfo #depokhits #depokfood #jktinfo #citayam #infojabodetabek - @depok.kini on Instagram

- Blursed_chicago

No más impunidad a estos asesinos al Volante. NO HAY QUE SEGUIR NORMALIZANDO que dejen personas lesionadas , muertas . Todxs somos peatones y ciclos. Por el egoísmo de un wn deja a una familia y amigxs devastadas . #nomasciclistasmuertxs #NoMasCiclistasMuertos #Repost @droneandrebel • • • • • • Santiago, Chile CONDUCTOR SUMAMENTE PELIGROSO E IRRESPONSABLE!!! Patente FF-JG-22 Hoy la nota negra la dio este irresponsable al volante y poco tolerante que causó el daño de algunos y algunas compa y de algo que pude a ver sido fatal!! Por esto mismo salimos a las calles por conductores tan mala clase como este!! Impotencia hacia este sujeto y máxima difunsion no podemos seguir sufriendo estos riesgos y que lo vean como un accidente 🙏🏻 #nomasciclistasmuertos - - #CHILENOSEVENDE #CHILEDESPERTO #CHILEDESPIERTA #NOAFP #NOMASABUSOS #RENUNCIAPIÑERA #PIÑERARENUNCIA #CHILE #SANTIAGO #PROTESTAS #CHILEGRAM #CHILENOS #PROTESTASCHILE #SANTIAGO #CHILE #PUEBLOCHILENO #lamarchamasgrandedechile - @revolucionciclista on Instagram

- Blursed tire changing

Cantik cantik kok di got, main ke rumah ku aja yuk. #jokestoday #karyarakyatdms #dewanmemesejarah #karyasiswaums #karyarakyatums #karyasiswaskm #originalrhm #karyaasosiasihmci #karyarakyatrrsms #infosejarah #internetpositif #internetnegatif #hatihatidiinternet - @raja_george_vi on Instagram

Pengamen anak anak makin rame, dinas sosial dan pihak yang berwenang blm ada tindakan.. Jngn sampe jadi jambi jadi jakarta banyak pegamen dan pengemis - @sekitar_jambi on Instagram

- @hoydiariodelmagdalena on Instagram

- Priest did a wheelie on my bike, not clickbait. Above us only God and the front wheel.

damn they just chill there, musta hurt like a bih - Follow @shonenwaves - @shonenwaves on Instagram

Sabtu, 3 Maret | Kecelakaan terjadi dini hari tadi sekitar pukul dua pagi di Underpass Pondok Indah. Kendaraan sedan melawan arah dan menabrak dua mobil beserta 1 motor. . info dari @bramynmndl @axlmarchello @rioalvando @endoesp @ismirosyadi @rvdhit @rezanurfadilah @ahmadagus27 @faruqikh @agnesiaapkw @dhanboy @rasyidalhaadii_ #jakartaku #jakarta - @jakartaku on Instagram

Operasi gabungan berkaitan dengan . PERATURAN WALIKOTA PASURUAN NOMOR 35 TAHUN 2017 TENTANG PERUBAHAN TARIF RETRIBUSI PARKIR DI TEPI JALAN UMUM . Operasi kali ini menitik beratkan pada sosialisasi kepada para juru parkir untuk tidak memungut uang parkir kepada pemilik kendaraan, karena dalam hal ini para jukir ini sudah di bayar oleh negara. . Lain halnya kalau mereka di kasih tanpa meminta, di perbolehkan karena itu adalah rejeki. Dan bagi siapa saja yang kedapatan dan di ketahui melakukan pungutan liar ( Pungli ) maka para jukir tersebut akan berhadapan dengan hukum. . . #Satlantaspasuruankota #DishubKotaPasuruan #PerwaliNomer35 #Pungli - @kominfokotapasuruan on Instagram

19 . sebuah kesempatan luar biasa, bisa berbagi keberagaman, bisa #BERGERAKSERENTAK bersama @aruslingkar @yklc.media @perahukaret_official (feat. @memet_gokil ) @diandrasofficial , dipandu dan berbincang ria bersama kakak @diajeng_budi yang menawan, tentu saja dengan dukungan @showcasemart dan @komunitasdjogja . dikesempatan yang sama, kami juga merayakan hari jadi yang ke-2 tahun. semoga dengan bertambah usia, bertambah juga karyanya, bertambah dewasa, bertambah lebar pertemanannya, dan bertambah perpanggungannya . salam hormat . #yogyakarta #bandjogja #punkrock #concert - @saintjimmy.jogja on Instagram

- Pepper rounds fired, Rochester NY aftermath 9/5/20

SEKITAR JAM .12.48 Siang Tanggal 19 SEP.2020. Telah terjadi OUT CONTROL DIDEPAN BANDARA SAMS DEPAN KANTOR BMKG BPP. hingga berita ini diunggah sudah di evakuasi oleh polisi dan petugas terkait. Dan masih dalam lidik polisi - @info_bencana_balikpapan on Instagram

🚨 #Castro 🚨 Accidente de tránsito, puente Llicaldad. #PRECAUCIÓN #CONDUCTORES #Chiloé - @erchiloe on Instagram

y’all voting for the r@pist or the other r@pist?? follow me for more memes @ajnosimp 🔥 follow me for more memes @ajnosimp - - - - - - #president #trump #memes😂 #joebidenmemes #joebiden #trump2020 #biden #donaldtrump #presidentialdebate #politicalmemes - @ajnosimp on Instagram

Sup👋🏽 Follow @climperz 👻 Follow @percbanditt 👾 - @climperz on Instagram

A dream doesn’t become reality through magic it takes Sweat Determination & Hard Work 🙏🏻 📝 . . . . . . #bikelife #nyc #keepthatwheelup #bikesupgunsdown #nopanic #bikesbringbonds #newyork #bikes #sebikes #like #share #repost #nike #aeropostale #combo #explorepage #viral #fatripper #pkripper #bronx #veetireco - @bikelife_flako on Instagram

Hmmm 😅😅😅 Hari ini siapa yg summori?? 📷 @dr_herp #ninja250fans - @ninja250fans on Instagram

😂😂(@thatsmytypeofdunk) - @thatsmytypeofdunk on Instagram

#BreakingNews terjadi bentrokan antar ormas di Portal Ciledug malam ini (29/09) belum diketahui penyebab terjadinya bentrokan ini. #bentrokormas #ciledug24jam - @ciledug24jam on Instagram

Reposted from @yrushmusic GIVE THANKS 🙏🏽 - Jah know.. 2018 when we started, our first video on YouTube got 800 views and not one soul believed we would make a ripple much less a wave. - IM PROUD of what we doing and where we reach. From Nothing to SOMETHING. - Who out there supporting trust me we know who you are, and for the barricades I see yawl too, but its too late to stop us now. Big up @skillibeng @guttybling @claimsrecords and E-Syde - 500K authentic views. Milestone for Urban Legend Records me & @iamthejakal - #Gold #CantStopWontStop - @3r40records on Instagram

തിരൂർ പഞ്ചമിയിൽ ഓടികൊണ്ടിരിക്കുന്നവാഹനം കത്തിയമർന്നു ആളപായം ഇല്ല വൻ അപകടം വഴിമാറി - @kl55tirur on Instagram

Polri Sat Lantas Jakbar, TNI, Dishub & Sat Pol PP kegiatan Operasi Yustisi PSBB pencegahan Covid 19 di Mangga besar Jakbar Cr TMC Polda #infojkt #infoterkini #infojakut #infoterbaru #jktinfoid - @jktinfo_id on Instagram

抱歉了,最後沒能完整的把你送走。 從阿爹過戶之後,一直用能省則省的方式保養,其實自覺開得也算小心(畢竟駕駛技術不是頂好😅),誰知道這一切還是發生了;其實真的很喜歡這台舊舊的小房車,裡面滿是以前跟家人的回憶,只可惜她已經不能再陪伴我們創造更多快樂的回憶了😢 RIP TOYOTA CORONA 1992-2020 - @keymancj on Instagram

Yang Lagi viral di Salatiga Mohon jangan di contoh, hargai pengendara lain ga usah ugal2an bor.. Kalo mau ugal2 ada tempatnya ⬇️⬇️⬇️⬇️⬇️⬇️⬇️ INGIN FOTO / VIDEO KAMU ADA DI GALERI Supermoto Pink 🌟Follow @supermoto_pink 🌟foto/Video usahakan menarik, HD & jelas 🌟Akun NO Gembok 🔓 🌟untuk VIDEO (IGTV) durasi lebih dari 1 menit bisa kirim WA ke 089659179279 & 0895334047718 🌟Hashtag #supermoto_pink or #supermotopink 🌟 Tandai @supermoto_pink 🌟Akun anda no privasi or di gembok ⬆️⬆️⬆️⬆️⬆️⬆️⬆️⬆️⬆️ #supermoto_pink #supermotopink - @supermoto_pink on Instagram

રાજકોટ- રાજનીતિ કી પાઠશાલા દ્વારા ઉત્તરપ્રદેશના હાથીરસના બનાવ અને બલરામપુરના બનાવ માં દેશની બે દીકરીઓના મૃત્યુ થયા છે તેને ન્યાય મળે તે માટે રાજનીતિ કી પાઠશાલા ના રાષ્ટ્રીય કાર્યકારી અધ્યક્ષ મહેશભાઈ રાજપૂત ની આગેવાનીમાં કેન્ડલ માર્ચનું આયોજન... #rajkotdistrict #rajkot #rajkotcity #rajkotions #rajkotian #rajkotian_gujju #rap #justice - @rajkotupdate on Instagram

🤭 #Tegalhits - @tegalhits on Instagram

All motor K _👤 @_allmotorchu.mgp __________________________________________________ __◾️THE TEAM◾️__ _🔻 @haonly__ 🔻 _🔻 @pure__oil 🔻 _🔻 @Team_a_line 🔻 _🔻 @whowantsthesaucee 🔻 _🔻 @hondalifestyle.tm 🔻 ______________🌀#Hondajunkys 🌀______________ #WhoWantsTheSauce #Acura #AcuraClub #Dailydriven #Honda #Hondanation #Hondaloyalty #Hondalove #Hellaflush #HondaFest #HondaLifestyle #Hondaculture #illest #Jdm #Jdgmnation #JdmGram #Ktuned #Lownclean #Vtec #VtecClub #Dragcartel - @hondajunkys on Instagram

Jingan pie to kie? - @temanggungkeras on Instagram

- a kid selling food with bicycle get bullied by a group of teen

Rabu (30/9) Berserakan selebaran salah satu brand Handphone sepanjang Jl. A. H. Nasution Ujungberung, dari pangkalan ojek Cijambe sampai Jl. Golf. Perbuatan siapa ini ?? - via @yr_snackbdg #bdginfo - @bdg.info on Instagram

After many mobile snatching cases in Bharuch, now such incidents are been reported from Ankleshwar too. Near Ankleshwar GIDC Vision School, while a young man was walking at night, two robber snatched up his phone and escaped on the bike. The GIDC police station has registered a complaint and similarly, a mobile phone snatching case from Panso Quarters is also being reported. On other hand, Police have registered a complaint after two mobiles were stolen from a room in a house in Arunodayanagar near Gadkhol village in Ankleshwar. .. અંકલેશ્વર જી.આઈ.ડી.સી.માં આવેલ વિઝન સ્કૂલ પાસે રાતે વોકિંગમાં નીકળેલ યુવાનનો ફોન ઝૂટવી બાઇક પર આવેલ બે ગઠિયા ફરાર થઈ ગયા હતા. જી.આઈ.ડી.સી.પોલીસ મથકે ફરિયાદ નોંધાવી છે તો આવી જ રીતે પાનસો ક્વાટર્સ પાસેથી પણ એક મોબાઈલ ફોનની ચીલ ઝડપની ઘટના બની હોવાનું ચર્ચાઇ રહ્યું છે. અંકલેશ્વરના ગડખોલ ગામ પાસે આવેલ અરુણોદયનગરમાં આવેલ મકાનના રૂમમાંથી બે મોબાઈલની ચોરી થતાં પોલીસ ફરિયાદ નોંધાવવા પામી છે .. #bharuch #amazingbharuch #bharuchi #ankleshwar #narmada #shaktinath #bholav #Zadeshwar #jambusar #jhagadia #netrang #kasak #panoli #dahej #gujarat #gujarati #gujaratnews #surat #vadodara #ahmedabad #ankleshwarcity #mycityankleshwar - @amazingbharuch on Instagram

La verdadera definición de destruccion total #crashspotting Mándanos tu foto para subirla! - @crashspottingarg on Instagram

Baru saja terjadi di kampung susukan bojong parungkuda Kabupaten Sukabumi Ada 2 laki laki yang mencari ustad dan warga nanya ada keperluan apa si dua pria itu malah ngotot dan mengajak berantem ke salah satu warga dan dua orang ini malah nyobek2 al qur an dan sejadah di gunting hingga ketauan oleh santri akhirnya jadi 2 pria itu di hakimi vido/foto : @ikin_parfume - @gallerysalafy on Instagram

Power Of Emak2 - @cirebonsosmed on Instagram

Jayapura, (28/9). Suara rentetan tembakan terdengar saat polisi membubarkan aksi damai menolak perpanjangan otonomi khusus (Otsus Jilid 2) yang digelar oleh mahasiswa Universitas Cenderawasih, Jayapura, #WestPapua. Jika kondisi demokrasi du Indonesia secara menyeluruh sedang memburuk, represi brutal aparat terjadi di mana-mana, maka bisa dipastikan Papua adalah wilayah yang merasakan semua itu dengan lebih buruk. Bahwa setiap muntahan peluru yang keluar dari senapan Polisi sedang mempertebal rasa nasionalisme bangsa West Papua, dan itu artinya mereka sedang mempercepat kemerdekaan sebuah bangsa. . . . From @aktivis.mahasiswa98 - @suara_aktivis on Instagram