Flying Profile Pics

airplaneflyplaneklmaircrafttravelholidaycathappy

flying chouda2

- Airlines

pinterest: @wivwah ♡₊˚ ୨ৎ・₊✧

united airlines

- [OC] F-106 in low level flight

🩰

ghost epic flying halloween aesthetic

- Transatlantic must not be too fun in one of these

https://pin.it/1AKy2W5

flying dumbo big ears disney cartoons

- Seabring Heavy dropship.

Little big spoon

The onceler

borboletas butterflies beautiful fly flying

- Airport I, Me, art markers, 2019

pilot cat kitten airplane

- Aircraft: Concorde

Little flying fiary

international womens day flying paragliding google

- Tattoo travel

Sweet And Kind Mom Finally Snaps, Gets Revenge On Neighbors For Their Loud Dogs

sunexpress sunexpress airlines flying plane airplane

- Warbirds

𖦹

eotm bat black fly flying

- PHOTOGRAPHY

https://pin.it/1AKy2W5

puppy flight flying puppy flying dog

- Military paint

WHERE WE BOUT TO EAT AT?😏

klm aviation aircraft airplane royal dutch airlines

WHAT an amazing event!😎Many thanks to my friends for making this possible. We are looking forward to the next visit in czech republic!✈ Stay tuned for the event video soon😉 #a350 #airbus #aviation #czechheaven - @ramy_rc_ on Instagram

superman flying

- My second flight lesson! You guys gave me so much support on my first one I wanted to update. Today I flew a different Cessna 172 and did the takeoff all by myself!

Funny Airport Signs That People Had The Guts To Hold

fly flying minhtraanf

Congrats to @armando_fattoruso for winning 2nd overall at the French CP Championships! Armando and @mario_fattoruso also won 2nd and 3rd in Speed respectively. . . 📸 @focalised - @pdfactoryteam on Instagram

⭐⭐⭐⭐⭐

24kivy michael jackson levitate levitating

9/1/14-9/1/15: 26hrs 9/1/19-9/1/20: 137hrs The ultimate goal is to get the airplane to be an extension of yourself. I’m definitely not there yet...but the only way to get there is to keep practicing. . . 📸: @js170b . . . . . . . . #flywithaopa #fattirecowboys #flyraf #flying #flyingmagazine #aviataircraft #husky #akbushwheels #saturday #weekend #fog #me #motivation #fall #autumn #september #offairport #wisconsin #aviation #sony #sonyphotography - @rosski715 on Instagram

palv flying car gyroplane flight mode dutch

- avion

iWokeup on TikTok

klm aviation aircraft airplane royal dutch airlines

- Airplane mobile

🍃🐈

butterflies flying pixel insect

- Aircraft Parts

cat airplane cute talitha flights

- Sharks

campanha maxsan ihara ufo spaceship flying

- Just Santa paragliding down the coast before the big night.

flying jetsuit fly jetpack viralhog

Spirits of UHCW staff and patients soared this morning, with a special fly-over from a Spitfire with Thank u NHS inscribed on its undercarriage.   The iconic blue fighter aircraft was painted with the special message along with 80,000 names of nominated local heroes to thank hospitals, communities and individuals who have been on the frontline during the pandemic. - @nhsuhcw on Instagram

dm4uz3 foekoe foekoe gaming the greenscreen room emoji

Elite London CONNECT: Textron Introduces King Air 360 @textronaviation has updated its popular Beechcraft King Air series with its new King Air 360. The updated flagship turboprop offers technological advancements in the cockpit, a redesigned cabin, and enhancements to passenger comfort. Find out more at: https://beechcraft.txtav.com/en/king-air-360 #privateflying #privatepilot #flyingprivate #pplholder #pplstudent #privatepilottraining #privatepilotlife #generalaviation #lightaircraft #flyinginuk #aircharter #charterflying #privateair #crosscountryflying #flyingclub #pilottraining #flighttraining #learningtofly #pilotlife✈️ # #flyingforfun #nightflying #helicopterflying #flyinghelicopters #helipilots #helilife #helicopters #fixedwingflying #flyingschool #aeroclub - @theelitelondon on Instagram

have a safe flight

Had a great time jumping out of this tiger! @elpasoskydive was rad can’t wait to get back there!! 🤘🏼🤘🏼photo: @christopherpatz 📸. . @uptvector @icarusbynzaerosports @tonfly_official @lbaltimeters . . . . . . . . . . . . . #lbaltimeters #flyfast #flying #skydiving #skydive #skydiver #skydivers #iloveskydiving #skydivingposts #skydiving_everyday #skydiveamazing #skydivinggram #skydivinglife #skydivinggram_feature #skydivingphotography #skydivingpics #skydivinglovers #skydivingrocks #skydivingpost #skydivingfun #uptvector #nzaerosports #gopro #goprohero #goprohero8 #milehighhub #O2F - @beaukahler on Instagram

fly space ship explore space galaxy

- Balsa models

igoge tiktok %E0%B8%AB%E0%B8%99%E0%B8%B5%E0%B9%82%E0%B8%84%E0%B8%A7%E0%B8%B4%E0%B8%94 flying fly

- Black and white lion

airplane take off travel vacation flying

- Superman #30 Solicited Textless Cover by Doug Mahnke (September 2017)

duckiezdao duckiezdaodamn duckiez damnduckiezdao duckieztothemoon

- Aircraft

amor balloons hearts flying float

- STOL AIRCRAFT

airplane dancing dance dance moves dancing airplane

- Rc model aircraft

flying kiss flying kisses flying kiss gif

Welcome to my office, the view is pretty neat @skydivephoenix #skydive #UPT #freefall #bucketlist - @jumpwithhunter on Instagram

klm aviation aircraft airplane airline

How bleepin’ cool is that? Shadow of my #plane today. @united - @kerryjbyrne on Instagram

quby cute adorable kiss flying kiss

A little formation fun in a Redbull themed Carbon Cub! #avgeek #aviation #aviationlife #aviationgeek #backcountry #bushpilot #bushplane #cubcrafters #carboncub #xcub #nxcub #generalaviation #planelovers #planegeek #pilot #pilotlife #stol #tailwheel - @cubcrafters on Instagram

klm aviation aircraft airplane royal dutch airlines

- AMERICAN AIRLINES POSTERS

video mattie drone fly high sky

- @_jimwah on Instagram

wonder woman gal gadot wonder woman1984 flying happy

- Airplanes, etc.

130718 kiss flying

- Aviation ^

andrew goldstein frnd maliboo song animation plane

- Modellflug

aaron chewning flying man rocketeer interstellar designz rocket

The perfect combo with @luca_sala_vx ... Thanks @catfish_photographer for capturing these amazing shots on board the plane PC6. @performancedesigns @pdfactoryteam @cookiehelmets @sunpathproducts @liquidskysports @cypresaad @alti2_inc @flight1sport @saliceocchiali_official #xrw #italy #pdperegrine #wingsuits #squirrel #flycookie #flight1 #flyingbettertogether #pc6 #pdfactoryteam #pdathletes #skyteamcremona #aftercovid #afterquarantine #skydive - @mario_fattoruso on Instagram

flying airspeeder hovering flying around flying drone

- waco biplane

superhero flight flying baby chick superheroes

- Amelia Earhart getting screwed by her Lockheed Martin Electra (Ratbat)

airplane fast flying low

Bills first run out, wish me luck 😂 #barrellroll - @taylormac77 on Instagram

praints

- Drones

flying aesthetic

- Blursed Relaxing

flying nudibranch pikaole flying away omw

Devi solo decidere e fare, Il resto sono solo chiacchiere, I rischi fanno parte del gioco... #sky #skydivesardegna #wingsuit #sea #skydive #sardegna #sardegnaofficial #sardegnagram #goprosardegna #gopro #brentobaseschool - @charlyxeddu on Instagram

flying airplane

Love this beast of a bird. Thanks @mauleairinc for crafting such beautiful and rugged machines! - @westmichiganyoungaviators on Instagram

doubledougs dougs f is for finchat flying

- About Airplanes

happy cheering great good job well done

𝗣𝗵𝗼𝘁𝗼𝘀 𝗼𝗳 𝘁𝗵𝗲 #atmo 𝗳𝗹𝗶𝗴𝗵𝘁 𝗲𝘃𝗲𝗻𝘁 𝘄𝗶𝘁𝗵 Marco Tiezzi 𝗶𝗻 @skydivefano . . . #paracadutismo #paracadutismoitalia #skydiving #folgore #epic #cool #hero #photooftheday #voloumano #skydive_passion #freefallcommunity #skydiver #jump #fly #bestoftheday #bestmoments #sky #sport #atmonauti #italiateam #track #atmonauta #canon #anglecamp #italy #humanflight #fano #bigway #skydivefano . @italiateam @skydive_pasdion @freefallcommunity @jointheteem @skydivebrand @paracadutismopertutti @adrenalin.zone @crazy.to.crazy @discovey @discovery.your.planet @danger @focus_ita @paragear @canonitaliaspa @canon_photos . https://www.facebook.com/catfish.in.the.sky/ - @catfish_in_the_sky on Instagram

campanha maxsan ihara ufo spaceship flying

Late evening flight with new pilots! Thanks @alvarokrodriguez for the shoot! #flyozone @ozoneparagliders - @matias_nombarasco on Instagram

bugs bunny reading fly flying pilot

Pretty little birds all in a row ready to ferry our #flightcrews to their flight assignments from our Project Lift Dallas hub at #ICAO #KDAL. #Phenom300 📸 by #Flexjet Vice President of Red Label Programs Richard Handschuch - @flexjetllc on Instagram

flying bird hummingbird fly bird

A father and son escaped serious injury after their light plane lost power mid flight this morning. They made an emergency landing on a quiet stretch of road near Warwick. #7NEWS - @7newsqueensland on Instagram

flying frenchman

- fun fly

wingsuit flying flying feeling it into the sky sports

This wasn’t my best exit, still working out a few bugs. Had a nice hike with @matechuk111 who was also Mr. Camerman on this jump as well. Thanks pal! . . . . #wsbase #basejump #squirrel #skydivegram #humanflight #gtfoutside #wingsuit #travel #alpine #scramble - @whatsmyvector on Instagram

sky plane doge memes kitty

- base jumping, skydiving

spyro flying spyro flying

- Skydiving Adventure

samantha flying bewitched witch flying on broom

- Week end pas cher

flying chouda

- Private Flights

flying cat

One of our favorite days of the week... Flocking Friday 🥳 #uspamembers enjoy a canopy flock at Skydive Midwest in Sturtevant, Wisconsin, the weekend after quarantine lifted. #Parachutist #flockingfriday #flashbackfriday #featuredphoto #fiveminutecall #skydivegram 📸 @_austingeorge ✈️ @skydivemidwest - @skydiveuspa on Instagram

rafsdesign rafs rafs84 rafsdesigns insta

So this happened yesterday! Thanks to @_kelseykirkland my sister and I jumped out of a perfectly good air plane for my sister’s bday. What an amazing experience! It was terrifying and exciting all at the same time. I would totally do it again in a heart beat! Thank you Kelsey! #skydiving #jumpingoutofplanes #freefall #terminalvelocity #scared #facingfears #parachute #skydive - @corey4photos on Instagram

flight patrickstar patrickmeme patrickstarmeme airplane

- I took this picture from my gopro today and thought I looked kinda cool

love you flying kiss

- Airpower Art Collection

ariplane happy bye up aircraft

- Lotnictwo

benjamin elephant pilot cute flying

- Airplane

super man fliying

- aviation

moon flying penguin flight traveling

- Sky Sports

delta airplane delta airlines flying

- Airports Around The World

abiera travel wanderlust sky clouds

Check ✅✈️ Skill test bestått i PPL-A (Private Pilot License) og approved av Arne Ribe sjøl 🙌 Endelig har alt det knall harde arbeidet til slutt paid off! Nå venter lufta og maange fine destinasjoner! 😎 ° ° ° #privatepilotlicense #ppl #check #vakrenorge #mittnorge #norway #sommernorge #livinlavidaloca #aviation #avgeek. #pilotlife #instagramaviation #aviationphotography - @jensmarkuslarsen on Instagram

airplane plane happy flying smile

- aviation

tkthao219 bubududu panda

I was born in San Jose, California, raised in Alaska and grew up in Hawai’i. My first tandem was in 2000 on the North Shore of Oahu and I didn’t think about skydiving again until 2008 when I began my skydiving career. I began Flying camera in 2011 for @skydivehawaii for 3 years. When I left Hawai’i in 2015 to pursue being on a Head Down World Record, who would have thought it would take me to live @skydivechicago and where I would become a tunnel instructor @ifly_naperville and move to instruct at iFLY Phoenix. Since covid....I’ve made my way back west and am enjoying the coastline of Southern California! It’s been such a pleasure to go jump and then surf, something I used to do religiously on the North Shore of Oahu. I’m so grateful for this life and learning to fly my soul to new heights! 📸 by @tomcik - @amberlyairborne on Instagram

puppy flight flying puppy flying dog im flying weee

- AEROPLANE

appintheair plane crew aircraft fly

Mirando hacia el futuro a pesar de la crisis. La empresa europea🇪🇺 Airbus presenta su prototipo de avión propulsado por hidrógeno en la búsqueda de un avión de pasajeros con cero emisiones para el año 2035. Estos prototipos plantean desafíos para un futuro sostenible del sector de la aviación y la transición al hidrógeno como fuente de energía primaria en lugar del queroseno. El sector aeroespacial está extendiendo sus alas hacia una aviación más limpia y menos nociva para el medio ambiente. - @alemaniaparati on Instagram

flying plane i love flying

El día de hoy celebramos el inicio de entrenamiento de vuelo de nuestro estudiante Piloto Privado Juan Arteaga - ¡Muchas Felicidades! 👨‍✈️ - #Enalas #PilotoPrivado #Flight #studentpilot - @enalas on Instagram

plane window sky travelling clouds flying

Just another day of mini golf for the Brave #palouse #cropduster #agaviation #windturbine #pylonracing #palousebrand #gopromax @gopro @lightspeedaviation @boneheadcomposites - @scottpalmerair on Instagram

safe travels

- Art | Drawing Photos | Pencil vs Camera

ufo unidentified flying object alien spaceship cute

- Aircraft

calvin and hobbes calvin fly clouds birds

- ITAP of an airshow spectacle

sunexpress airplane plane flying holiday

- Gaming pc build

lufthansa views lufthansa group lhg airplane heart

- About Airplanes

airplane joypixels flying aeroplane aircraft

- Vintage Airplane Nursery

delta airplane delta airlines flying

- Jean Mermoz

drawing rabbit sketch flying happiness

- America the Beautiful

delta airplane delta airlines flying

G-IRTY returned to @goodwoodaerodrome today. It was great to have her with us for a few days! 😊 #boultbeeflightacademy #silverspitfire #longestflight #spitfire #spitfires #mkix #spitfiremkix #gilda #sm520 #girty #mj271 #warbirds #wwiiaircraft #exeter - @boultbeeacademy on Instagram

fire cat flying clouds smile

- My friend did a presentation in class on his life dreams

lol

She may not look like much, but she’s got it where it counts. I can fly, I’m an {instrument} pilot - @ma_honey_5 on Instagram

turtlecoin hummingbird turtle flying bird

- ww2 timeline

flight fly flying tina belcher bobs burgers

- Outdoor Fun and Sports

safe flight have a safe flight save travels bye plane

- Commercial plane

united airlines flying airplane

- Bubbles

die fly flying birds sky

- Kite making

klm aviation aircraft airplane royal dutch airlines

Our mate @dave_hyndman livin the dream up here in Jurien Bay - @skydivejbay on Instagram

white bear cute fun flying

- Bucket List

flight fly flying adultswim cartoonnetwork

- Flying

small airplane fly flight airline aeroplane

- Caudron C.460

happy finally leaving vacation time celebrating

Shine on the road, water, or even in the air! This Cirrus SR22T got a nice polish just in time to take to the skies in style! Let us help keep your vehicles in pristine condition! #planestrainsandautomobiles #cleanerlife - @distinctlydifferentdc on Instagram

mochi cute flying fly away outta here

- rc helicopters

cat flying i am coming for you cat flying

- Air Races, Danger Abounds!

flying cute adorable plane sky

- Sky Adventures

fly plane bad ass ride diva

- These wind up planes

party travelling clouds high up colorful

- Art ( airplane)

camsey snoopy flying fly peanuts clouds house

Above the beautiful lake Saimaa in Finland 💙 Photo by @lauriaapro #fly #skydiving #indoorskydiving #windtunnel #airdancer #flylikeagirl #adrenaline #acrobatics #womenwhofly #fastandfurious #deemflywear #tonfly #cypresaad #lbaltimeters #uptvector #nzaerosports #lvnlifestyle - @inkatiitto on Instagram

buddingpop leaf flying

- Art + DEsign

lot flying plane wings of a plane

- Badlands

- AIR PLANES Art

- fav

#tntbrothers & #hawksofromania @tnt_brothers . . . . . . . . . #HelloFrom #romania #skydiving #skydivingposts #bucharest #pilatus #pilatusporter #extraaircraft #summer2019 #dropzone #topromaniaphoto #skydivinggram #instagram #instasize #lovetofly #bluesky #tbtsummer #aeroclubulromaniei - @mihailiviu on Instagram

This season was anything but normal, but you, the Right Fork family, helped keep the days bright ❤️☀️ . Thank you again for your support this summer, and always. See you next year 🙏 . . . . . #TheRightForkDiner #TheRightFork #EdgartownMA #MarthasVineyard #VisitMV #foodstagram #instafoodies #instaeats #breakfastisserved #breakfast - @rightforkdiner on Instagram

- Pilot license

AT-3 with @kuba_at3 over Warsaw ✈️ Thanks @mikolajtolkacz as a photoship pilot! #aero #at3 #aircraft #general #aviation #training #flight #formation #aerial #view #aviation #photography #airtoair #team #city #clouds #warsaw #poland #vistula #river #skyscraper #avgeek #sun #canon @canonpolska - @filipmodrzejewski on Instagram

- Aircraft and flying balloons

- beautiful photography

- CHAMBER | ACTIVE : SS16 : FORECAST

- aviation

- a9

- autogyro

- Aeromodelismo: Aeromodeller

Wow. You guys are freaking amazing. I felt ALLLLL the love from my post yesterday. I literally have the best community ever 💗 ⠀ I know that I’ve had a lot of new beautiful babes join the MB community over the last few months so I thought this morning I would share some fun random facts about me & hear some of yours! ⠀ Here are some random facts about me in no particular order 👇 ⠀ 1. In my 1st grade yearbook I wrote that I wanted to be a princess when I grew up. Yes ACTUALLY 😂 ⠀ 2. I played with Barbies until I was 15. ⠀ 3. I ballroom danced competitively for 10 years (competitions, fancy shmancy dresses, the whole shebang. Long before Dancing with the Stars made it popular 😉) ⠀ 4. I was born in Ukraine but I’m Russian-American. Yes, I speak fluent Russian! I can also read & write but it takes me muuuuuch longer than English of course. ⠀ 5. I was going to become a dermatologist because I love popping pimples & still watch pimple popping videos on YouTube 😂 ⠀ 6. I was once an artist when I was a kid & even had one of my paintings make it to a museum in Europe. I can’t paint for sh*t now. ⠀ 7. I was so shy growing up I never ONCE raised my hand to speak in class. Not EVER. ⠀ 8. When I was 18, I kept telling my boyfriend I was going to be a millionaire by 25. Well, I became a millionaire at 25. ⠀ 9. I Recently became obsessed (like OBSESSED) with studying human design. I’m a 2/4 sacral generator. ⠀ 10. When I was born I contracted a staph infection in my brain. Doctors told my mom I wouldn’t live past 1 years old. And if by some miracle I did, I’d be in a wheelchair unable to walk. Neither happened & by the grace of God I’m still here 🙋‍♀️ ⠀ 11. I went skydiving in Dubai (pictured above) after seeing this place on YouTube & saying “if I ever skydive in my life it’s going to be this place.” Well I manifested it 😂 ⠀ What about you?? What are some fun, random facts about you? The weirder the better people😝👇 ⠀ #ManifestationBabe - @manifestationbabe on Instagram

- Aviation/Flights

- I have such a feeling of accomplishment when I see people printing my projects in other corners of the world. That design that was only in my head some time ago...

DREAM 🪂 . Ça fait des années que je rêve de faire du parapente, et pouvoir voler dans les airs pour ressentir ce sentiment de liberté ultime Et me voici sur la dune du pyla à diriger ma voile. . Je viens de passer une première journée INCROYABLE ! . Merci a ce petit gars qui minitie et qui prend le temps de me faire vivre se rêve inoubliable. . #fly #speedflying #parapente #paradise #dunedupilat #extremesports #dream #freedom #addictionhappiness - @loury_explorer on Instagram

- aeromodelismo

Please help us congratulate Luc Zipkin, who soloed today! It’s been a fantastic summer of first solos and ratings achieved by our campers, and we couldn’t be more proud. Well done Luc! 💯👏🏻#youthpower #firstsolo #vermont #aviation #glider #flightschool #sugarbush #madrivervalley @towpilot @luczipkin - @soarsugarbush on Instagram

- SKYTEAM ACE

- Plane photos

- Airship

Beautiful blue bird day! This weekend shaping up to be a goodie! · · · · · #nzmustdo #purenewzealand #iloveskydiving #nztourism #newzealandguide #explorenz #skydivinggram #skydiving_everyday #travel #foxglacier #destinationnz #NewZealand #earthpix #skydiver #discover_newzealand #skydivingpics #travelnz #newzealand #franzjosefglacier #skydive #DoSomethingNewNZ #jointheteem #tandem #skydivingadventure #southislandnz #parachute #skydivegram #newzealandnatural #glaciercountry - @skydivefranz on Instagram

Sesongen er enda ikke over og vi kjører på med et kanon tilbud den siste uken!! Alle som hopper tandem denne uken får 💙GRATIS💙bilder med på kjøpet. Tagg en venn i kommentarfeltet (eller 10?) og vi trekker to heldige vinnere som får 1000kr rabatt hver på tandemhopp! Husk at dette må benyttes innen 3. Oktober! Vinnere annonseres i morgen kveld 🥳 AVSLUTTET!! Vinnere av konkurransen var @helenakvammen og @marevensen 👊🏼 - @skydivevoss on Instagram

- Boeing

- Quest KODIAK

- Balsa models

- Flying

Présente son coup de ❤️ ! 📸 : @captainyvon Chaque jour, découvrez les richesses de Normandie 🌳⛵️🗺📍 #normandy #normandie #normandymylove #ignormandie #ignormandy #lanormandie #la_normandie #normandietourisme #normandiejetaime #amoureuxdenormandie #montsaintmichel #saintmichel ▶️ Taguez #amoureuxdenormandie sur vos plus belles photos normandie - @dunord_ausud on Instagram

- aircraft

- Other Aerial Vehicles

- Roasted cabbage

Whoa. @AlaskaAir is offering passengers an opportunity to have a whole row...to themselves! When you book your flight you can get a second ticket on that same flight for just the taxes and fees. Deal ends tomorrow night. bit.ly/3iBTTz1 - @renoairport on Instagram

- Aviation

- Art

anytime is good to fly . . . . Repost from @fathir79 #paraglidersindo - @paraglider_indonesia on Instagram

- +700: Follow

- Glid ...

Snap rolls into the sunset🤩 Oh geeez😆 Thanks David👍👊 #extra300l #inverted #goneballistic - @mjrally on Instagram

No story here. Just a #grasshopper with big #balloon #tires. @akbushwheels * #bushpilot - @tok_air_service on Instagram

- A blind rhino being rescued by a helicopter

- Terminal Velocity -Eken H9, Photo by Seep

- Pulsar

This is what a flying doctor 👨‍⚕️ 👨‍✈️✈️ looks like! Dr. Michael Clements collecting his certificate for gaining his Multi-Engine Class and Instrument ratings last week. Congratulations to our favourite flying doctor! 👨‍✈️✈️ . #multiengine #instrumentrating #piperseneca #learntofly #flyingdoctor #tsvfligt #avgeek - @townsville_flight_training on Instagram

- Outdoor Advertising Campaigns

Was hesitant to post until all test flights went well and after 10 hours of flight time, all checks are good! ✈️ The only issue on the first flight was the pitot tube and static port was backwards, window latch didn’t want to stay closed, and needed some rigging adjustments. Not bad right? ✈️ It’s finally rigged and flying hands off. We are easing into anything too aggressive until we know everything is good. Time to go through every nut and bolt and then start some aerobatics! - @vintageaviationny on Instagram

- AIRPLANES

- At the Airport

This bridge was almost too big to crop for Instagram 😅 one of the sickest days I’ve had in a while out here on the @thecliffcruise. Mad props to everyone that hit this thing, big bridges into flat water are no joke! Thanks for the 🎥 footy @brandonwgross & @fahary Also swipe for some 🔥 @yo_bridge got of me from under this beast! . . . . #cliffjumping #cliffdiving #diving #sendit #extremesports #goodtimesonly #nature #waterfall @volcom #volcom - @robert.wall on Instagram

- Mimicking the Matterhorn

View from the top! 😍 #PalmJumeirah #SkydivingInDubai #VisitDubai #Weekend #SkydiveDubai 📷Marat Leiras - @skydivedubai on Instagram

- FLY machines

What is National Composites Week? You may not know it, but composite materials surround you. They are used to manufacture commercial aircraft structures, fighter jets, car and truck parts, railcar parts, wind turbine blades, fishing boats, fishing rods, golf clubs, tennis rackets, medical prosthetics, etc. Composites are pound for pound, the lightest and strongest materials globally and are a fast-growing part of the global manufacturing economy. For that reason, we are joining hundreds of other businesses in the composites world to celebrate National Composites Week, Aug. 24-28, 2020. There are thousands of companies in the U.S. that operate somewhere in the composites manufacturing supply chain, providing technologies, services, and parts for the aerospace, automotive, marine, energy, industrial, sporting goods and medical end markets, to name a few. By celebrating National Composites Week, we will highlight the importance of composites manufacturing and introduce as many people as possible to these operations significant role. National Composites Week is a chance to celebrate the innovation found within the Composites Industry, which helps transform the world. We would like to see photos of projects you are working on that are utilizing composites. Please tag @revchem and include #nationalcompositesweek and #CompositesAreEssential to your next composites project post for your chance to *win! Please help us show the world how composites are used every day. * TAG 2 WIN Rules. Tag @revchem and include the 2 hashtags: #nationalcompositesweek and #CompositesAreEssential in your post of a composites project you have built or worked on. We will choose three winners each day at random through August 28th to win a free Revchem Face Mask. We will direct message you for your mailing address. Masks are mailed the same day the winner is chosen. If you do not respond to our DM by the end of the day, we will pick another winner. By submitting your photo(s) to us, you agree that they may appear without monetary compensation on www.revchem.com and our other social media platforms. - @revchem on Instagram

- LEAKED E5 Scorpion Ammo Upgrade

- Human Boundaries Questioned...

- In The Fast Lane

- Antony Gormley sculptures

- Nolan film

Leading team Italy in 2013, 2015, 2017, 2019, ... 2021? Aaron Durogati 🇮🇹⁣ ⁣ Mark your calendars for the Athletes Announcement 👉 October 14, 2020!⁣⁣ ⁣ 📷 Sebastian Marko / zooom⁣ ⁣ #redbullxalps⁣ #paragliding⁣ #puremountain - @redbullxalps on Instagram

- Aviation

- Air Outdoor Activities

- How to draw an airplane

- Aircraft

- Aliens - UFO

- _material / texture

“A sua loucura é a minha rotina” 🤟🏻🦅 Voando com a @priscila__ignacio Dia lindo. #joevoador #parapente #asadelta #GoPro #universowollner #hbbrasil #pedrabonita #cariocando #quarentena - @joevoador on Instagram

- Fethiye

i will meet you in the sky #skydiver #aerobatics #stunt #ukraine #extra330 #skylovers #jointheteem #birdmanteam - @kypka0 on Instagram

- Base Jumping / Sky Diving

Raincircle!! Because rainbow is boring... 🌈😴 - @juliet.sierra on Instagram

The first of the monarchs have arrived! Tim Thompson took delivery of his beautiful custom @willswing S3 and welcomed it to Lookout with a great soaring flight. A few more of these should be coming in soon to decorate the skies! #hangliding #freeflight #gliders #custom #willswing #hanggliders #flyslowlookflashy #flylookout #chattanooga #flylikeabutterfly #monarchs #prettycolorsinthesky #flytherainbow - @lookoutmtnflightpark on Instagram

ELŐSZÖR A LISZT FERENC NEMZETKÖZI REPÜLŐTÉREN Eric Linkweiler gyakornoki program keretében érkezett hozzánk Németországból, előtte még nem járt repülőterünkön. Nézzétek meg képekben az első találkozását a Liszt Ferenc Nemzetközi Repülőtér forgalmi előterével. 📷 @ericlkr FOR THE FIRST TIME AT BUDAPEST FERENC LISZT INTERNATIONAL AIRPORT Eric Linkweiler arrived at Budapest Airport from Germany, as part of an internship program. He had never been to our airport before. View his first visit to the apron at Budapest Airport in our pictures. #airportlife #apron #budapestairport #lovemyjob #momentsatbud #firsttimeatbud - @budapestairport on Instagram

- seaplane

- The Spitfire. Thank you John Dibbs......shes beautiful!

“Brotherhood II” 48”x10”x3” 2019 Laser cut acrylic, die cut vinyl, binding screws, spray paint, fishing reel, fishing line, fishing lure, fishing rod guides, metal split key ring From “Dream of the Shore Near Another World” Harlesden High Street London, UK June-July 2019 - @avery.noyes on Instagram

📷 @marcweilerphotography erwischt @rawham.mcl airline 🛩 im Landeanflug Samedan Airport. #breakingboundaries #mysticswitzerland #engadin #silvaplana - @mystic_switzerland on Instagram

Congratulations and happy 16th birthday to the world’s newest Aerobatic Pilot. Today @owenfitzgerald44 soloed the Decathlon and flew the IAC 2020 Sportsman’s Aerobatic Sequence in one flight. What a great birthday. He has worked hard for this day and we are all very happy and proud. Great job Snort! Welcome to the club. 👊 - @aaronfitzgerald105 on Instagram

- Stunt kite

- Ultralight plane

@tanguy_tms flying high in the sky in Lacanau 🦅 📷 @saycheez_prod #addictedtoride #fanaticfoiling #skywing #wingfoiling #foiling #upintheair - @fanaticfoiling on Instagram

- MARIGOT BAY

- Chris Foss

- avion

If you are not passionate, you are wasting your time 💕 . #Repost @pe123tra 📸@npp_foto . expano #beachvibes #innhopp #skydivegram #skydivingposts #skydivingpassion #flyicarus #icaruscanopies #nzaerosports - @icarusbynzaerosports on Instagram

First of all, wow- thank you for the outpouring of love and support, we never dreamed we’d reach so many people. We really appreciate everyone reaching out to us about this unfortunate situation. We’re shocked at how much support we’ve gotten and are truly grateful by everyone’s offers and well wishes. We’re trying to respond to everyone who has asked questions, but there are so many it is hard to keep up. Many people have asked about a fundraiser of some sort in order to repair the DC-3s. We are humbled at how quickly people were willing to offer assistance. These are very kind offers, however we are really just looking for information and awareness, not for money or donations. We have never been people to accept charity, and especially not in the condition our world is in right now. So many people have lost their jobs, had hours cut back, and are struggling with the effects of COVID-19 that we could never consider accepting money. Both Sid and his son Chris are licensed A&P IA mechanics, so they are able to fix this damage over time. Sid will rebuild the flight controls that were wrecked, but it is a major set back. We are still looking for any information you may have, so please continue to share and keep your eyes open. - @capecodairfield on Instagram

Scott Mason - @capturingtheworldgopro on Instagram

When you have the Passion gives you the motivation to keep trying #missionhumanflight #expo2020 - @a7med_alshe7i on Instagram

Same page, different name! We have officially started a restoration/tailwheel training business! Can’t wait to show the newest restoration project that we started this past weekend ✈️ - @vintageaviationny on Instagram

#gliding #myhobby #planes - @andrej12112 on Instagram

- Xtreme sports

É preciso ter determinação, autoconfiança e altas doses de coragem para riscar o céu. E é isso que nos inspira todos os dias! #hangar33 #feitoparavoar #aerobatics - @hangar_33 on Instagram

- Art

- Airplane illustration

- Light sport aircraft

Jugando con la gravedad, aunque ella está destinada a ganar! #vsco #vscocam #skydive #skyporn - @daveskap on Instagram

- Bariloche

- This cracked windshield on a car looks like a bird

- Cessna Aircraft

- Dragon tattoo with skull

- B17

- Bush pilot

✈️ The brand new @airbus #A350 made by @ramy_rc_ - this was during the shooting of the new video - GO WATCH IT! 🚀 #rc #rcplane #plane #airliner #rcairliner #jeti #frsky #filming #modellbau #modellflug #diy #handmade - @loebair on Instagram

Windy days in 🇨🇭🤙 Thx for 📸 @windwasserwellen & @christian.woufi - @ensis.watersports @mauiultrafins @strizyboards - #wingstyle #wingfoiling #wingfoil #wingsurf #surfoil #foiling #swissmountain #Swisslake #strizyboards #muffoil #ensiswing - @rawham.mcl on Instagram

Today is National Airborne Day! We want to thank all the past airborne forces who have paved the way and all those who continue on! . 📸: @johnos.photography - @blackdaggerspt on Instagram

- Airline Flights

- HELLENIC AIR FORCE

Well. I owned this 1947 Stinson for about an hour and a half. Had an engine failure in mid flight on the way home. Thankfully my instructor was in the plane and we got down as safe as possible and I survived my first plane crash with essentially zero injuries. A real solid reminder this ain’t some soft shit like golf. I’ll just have to go back to finishing the project. Time for a few beers. - @north.east.wings on Instagram

- Cessna 150

- Angel of the North Gateshead

- Best MODs!

- Yakovlev Yak-3U Steadfast

I dont often get enough wind to swing out on a Mega Loop so my landings are still a little off 🤦🏻 🎥@jamesropner @corekites #gokiting #corekites @corekitesusa - @ericrienstra on Instagram

- Planes wrap

- Microlight aircraft

Thats how you take off in a #pipercub! 🚀🛫😛 • Great shot via @brush_pilots • #takeoff #taildragger #j3cub #piperaircraft #yellowplane #verticaltakeoff #bushpilot #bushflying #flying #adventure #generalaviation #pilotlife #pilotsofinstagram #pilot #privatepilot #plane #airplane #planelovers #aviation #avgeek #avnerd #aviationphotography #avi_things - @aviation_things on Instagram

- Windsurfing

- Mobiles

• • • #igersmexico #igerschiapas #ourstreets_ #igersguadalajara #StreetsGrammer #_enlacalle #eyeshotmag #fotografiacallejera #streetgrammersmx #sonyworldclub #streetphotography_mexico #burnmyeye #nonstop_street #lightboxcommunity #streets_storytelling #streetsansfrontieres #in_public_collective #streetsgrammer #timeless_streets #everybodystreet #streetphotographymagazine #people_infinity #zonestreet #natgeoyourshot #nonstop_festival #HCSC_street #insidephotos #35mmstreetphotography #gf_streets #remotexpeditions - @o.r.l.b on Instagram

- Before I Die

First time back flying in 3 years today! Great to get back up although hectic wind conditions, considering if I can afford to return to it fully 🤔😝 #staplefordflightcentre #cessna152 #lightaircraft - @rosshenderson1927 on Instagram

- AVIATOR BIRTHDAY THEME

- ITAP of some planes

- PsBattle: Couch paragliding

- Foam RC Airplane

ULTRA excited to go on its first flight real soon 🚀🚀🚀🚀🚀 Dream project with great people . Over a year ago, Felipe Pantone, Joan Escribá, and Joan Comas got together to plan the construction of the INTR3PID, a Carbon Cub which is the highest performance adventure aircraft in the world. Lightweight and powerful, the INTR3PID livery designed by Felipe Pantone seems to enhance the dynamic properties of the classic Piper Cub, an American light aircraft first built in 1938, on which the Carbon Cub is based. . 📸: @super__fuerte / FP Studio . #intr3pid #felipepantone #art #carboncub #joanescriba #aviecom #smallplane @delimbo #lightaircraft #pipercub - @felipepantone on Instagram

- avião/aviador

Heavenly | Braies First Light - @harryschuler on Instagram

- Airbus

- Aeromodelismo: Aeromodeller

Already reminiscing about the star search 3.0 night jumps @skydivechicago 📸 by @ryanpatrickproductions - @amberlyairborne on Instagram

Viaje inolvidable 🦒🇿🇦 - @juanfrarobles_ on Instagram

- Aircraft Safety Card Design Inspiration

Another killer ride through the clouds the other day. This time @pilotmaz_theclouddancers took my good friend @thekianaj for a ride in his beautiful Pitts S2B as he and @j_cub_r flew formation. They later broke off and flew some crazy aerobatics maneuvers, which would be a treat to see under any circumstances, let alone from another plane. Huge thanks to all involved. #aviation #pittsspecial - @a.fasc on Instagram

- The Christen Eagle II radiates fun!

- BASE Jumping

Strutless design, an IRS bridle configuration, and a canopy made from Teijen D1 fabric the lightest weight ripstop available. The UFO V1.1 is built for unbelievable handling and space-age drift. Learn more on our website: https://slingshotaustralia.com.au/collections/kites/products/slingshot-ufo-v1-1 #wewillshredagain #ufo #kitefoil #kiteboardingzone #foilkite - @slingshotaustralia on Instagram

- A frame from an air to air shoot I did yesterday

- Sports equipment storage

- Russian Su-27 Flanker intercepting a US B-52H above the baltic sea. (864x454)

- A “Horizon Wing” Atomic Passenger Jet

Having fun over #Dubai with @nicholasscalabrino . . . #missionhumanflight #expo2020 #dubai #skydive #wingsuit - @a7med_alshe7i on Instagram

Name a better feeling.. Go ahead? We’ll wait 👽 - @miragecontainers on Instagram

- Adversitments

- ocean shores, Washington

- Aeromodelismo: Aeromodeller

- Blowing in the Wind

One of the best lessons we learned during our “Tame Hack Plus” experience this summer was the importance of having a group of siblings to chase and interact with each other. This naturally takes the focus off the falconer, who then remains just a positive presence, part of their world everyday yet off to one side, handling and hooding, assisting in the routines they come to anticipate. And the best possible tool we know of to stimulate the chase, to continue the idea of “directed development” in the absence of parents at this stage, is hands down the @berghwingmkii. . All photos by the capable and pleasant @kristafeather - @marshallradioworld on Instagram

- Bubbles

- Just flying my shark kite.

Gökyüzüne bakıp kuşlar gibi uçabilmeyi hayal etmek bulutlar kadar gerçektir.😇🙏💙🇹🇷 . Bilgi ve Rezervasyon 📞 0553 453 80 00 . Looking at the sky and dreaming of being able to fly like birds is as real as clouds.💙💙🪂🪂🇹🇷 - @aliunlu92 on Instagram

- Airplane flying

Mente, corpo e alma, ali, no presente, no agora, deixando o coração sentir tudo que ele precisa. 💙 Relembrando, já que ontem teve revisão. 🪂 14º salto. Ansiosa pelo dia que vou conseguir sorrir na saída do avião. 😊 - @fernandaschwarzrock on Instagram

Kite party @nationalarboretumcanberra - @wright.kite.club on Instagram

- aeroplane flying

- Sky Sports

- Aircraft WW 1

Repost from @sebastianalvarez._ shredding the sky with @rseib 📷 @rseib #skydive #skydive_pictures #squirrel.ws #uptvector #turbolenza #skydiveandes #aerialphoto #gopro #cypressaad #pdcanopies #wingsuiting #superphoto #skydiveperris #livethedream - @skydive_pictures on Instagram

#sunflyers #paracadutismopuglia #sky #salento #sea #adrenaline #puglia #skydive #paracadutismo #freedom #viaggiare #emozionati #lecce #tempo #vivere #love #word #taranto #bari #foggia #brindisi #gallipoli #puglia #clouds #viaggio #life #bestoftheday #follow #fun #gang_family Sunflyers Paracadutismo Puglia lanci tandem e corsi di paracadutismo aff per info o prenotazioni sunflyers.it o 3925961723 Renato - @paracadutismopuglia on Instagram

@a7med_alshe7i at home over palm Jumeirah. It’s insane to see how quick you have picked up wingsuiting . . . @xdubai @squirrel.ws @dirtyhabitstv @icarusbynzaerosports @tonfly_official #flysquirrel #freak3 - @nicholasscalabrino on Instagram

- Steampunk Lego

- Aviation Decor

Throwback to 2015 - 3,2m aaaand 3,6kg RTF ✈️ this was my first big build and the first plane I was building every single part by hand. The whole design is done by me and this is all wood! I was proud as hell and this was such a big deal for me and this made me start to overthink the classic building techniques of model aircraft because I wanted to have something super light weight! Even the costs of building this was super low, only about 350€ for the whole plane, which was a lot considering I was a stundent going to school earning no money at all. This project got me and this was the start of Löbair! The flying characteristics were amazing due to the low weight. Looking forward to new projects ! I hope I can fly her soon again, she’s still waiting inside my hangar being covered with a cloth. ✈️🚀 #rc #rcplane #piper #handmade #homemade #diy #modellbau #modellflug #bauen #wood #oracover #multiplex #flying #aircraft - @loebair on Instagram

- Not sure if this is allowed, but today was my first time in an airplane, and my first time flying one. Its always been a dream of mine but I never had the resources. I finally made if happen in this Cessna 172.

- RC Gilder

- airplane

- @australia_aviation on Instagram

- Wing Walker | Bronica ETRS | Zenzanon 75mm MC | Ektar 100

Lovely shot of the new #kingair 360 provided by @textronaviation! #flyingfriday #kingairnation #beechcraft - @kingairnation on Instagram

- Adventures

- The best picture Ive ever taken, 7 years ago today. (F-22 demonstration at the Waukeagan Air Show)

Happy Fall! 🙃 - @skydivecoastalcarolinas on Instagram

- Bungee Jumping

- Airplanes

- Hottest Sporting Events!!

- Baby Room Ideas

In love with my new companion, the #phigliders Viola 12. Awesome fun descending after a #bordairrace training day with 3000m altitude gain. #hikeandfly - @david.hasko on Instagram

- Color Funtime

Flyin -n- Skydivin w/@skydivecoastalcarolinas @flysunshinefly & @chase.wingsuit . . #sky #skydive #skydivers #skydiving #blueskies #bluesky #skydivingposts #beach #vacation #vacationmode #beastmode #badass #dailymotivation #motivation #sony #sonya7iii #sonyalpha #gopro #goprohero8 #goprohero7 #goprohero #family #familytime #vacation #bluesky - @prestonmonoc on Instagram

Avez-vous sauté cet été? 🌬 . . . . #montsaintpierre #gaspesie #quebec #trip #naturelovers #hiking #tourismegaspesie #mountainscape #outdoors #landscape #explorecanada #instatraveling #hanggliding - @montsaintpierre on Instagram

- Christmas in Australia

- Aircrafts

- Bucket List (Not Pie in the Sky)

- Red Arrows

- Small airplanes

- The streetwear bot needs some link karma to bypass captcha and post recurring threads, please upvote this post

- Paragliding

- Electric planes

- North Kites

- Airplanes

Repost @goprobombsquad Coming to get you! 📷@marshall__miller - @gopro_hero_nation on Instagram

- Family room

- Go for it! (Running, Swimming; Living)

- Dirigibles

Gotta work on those misty shits 😂🤦‍♂️ . #mistyflip more like a #mctwist and #ineedanacrowing . #acroparagliding #acrobatics #paragliding #paraglider #paraglide #hikeandfly #thermals #thermaling #soaring #puremountain #CUMEO #BREEZE #skywalkparagliders #purepassionforflying #weareparagliding #speedflying #tandemparagliding #weliveparagliding #xcflying #crosscountry #gleitschirm #gleitschirmfliegen #gleitschirmflieger #parapente #parachute #parapendio #cloudbase - @timker_ on Instagram

- Lockheed P 38 Lightning

- New Technology

- Alas delta

- The Lockheed Martin CL-1201 drawn to scale. LM actually designed this in 1969 as a nuclear powered airborne aircraft carrier. Weighed 5,265 tons, thrust 15,000,000 lbs, crew 845, endurance 41 days, VTOL from 182 vertical turbofans, carried 22 F-4 phantoms or 6,900 troops.

Hey all you cool cats and kittens, in tough times I’m bringing you some good news. My new #moth has a name. Wendy jnr jnr is gone. I would like to introduce: Carole Baskin 🐅🐆🐈 - @kinleyfowler on Instagram

This is my favorite of the photoshoot at the airstrip ✈️ . . . #poledance #poledancenation #poledancersofinstagram #polephotography #pole #polegirl #polerina #polestar #polelove #poleaddict #poleart #polesport #poletrick #polemove #polemotivation #polefitness #photooftheday #bravogreatphoto #youcandoit #fitness #fitnessgirls #fitgirls - @cups_of_d on Instagram